Recombinant Oenothera glazioviana Cytochrome c biogenesis protein ccsA (ccsA)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Oenothera glazioviana ccsA

The recombinant Oenothera glazioviana cytochrome c biogenesis protein ccsA (ccsA) is a full-length, N-terminal His-tagged protein (1–319 amino acids) derived from the ccsA gene (UniProt ID: B0Z592). This protein is critical for the biosynthesis of chloroplast c-type cytochromes, such as cytochrome f and cytochrome c6, by facilitating heme attachment to apocytochromes .

Key Features

  • Function: Essential for the maturation of chloroplast c-type cytochromes via heme ligation .

  • Source: Expressed in Escherichia coli using recombinant DNA technology .

  • Relevance: Serves as a model for studying cytochrome biogenesis and plastid-protein interactions .

Amino Acid Sequence and Tagging

FeatureDetails
Sequence Length319 amino acids (1–319aa)
His-TagN-terminal 10xHis-tag for purification and detection
Molecular WeightPredicted based on sequence (exact value not provided in sources)

Expression Systems

Host OrganismApplicationSource
E. coliHigh-yield production, purification

Mechanism of Action

  • Heme Attachment: ccsA catalyzes the covalent attachment of heme groups to apocytochrome c subunits, a critical step in cytochrome maturation .

  • Genetic Dependencies: Mutations in ccsA disrupt cytochrome f and c6 biogenesis, leading to defects in photosynthetic electron transport .

Functional Partnerships

  • CCS Complex: Interacts with nuclear-encoded CCS1–CCS4 proteins to form a multisubunit heme attachment complex .

  • Stress Response: While O. glazioviana exhibits copper tolerance, ccsA’s role in stress responses remains unexplored in current literature .

Experimental Utility

ApplicationDescription
Structural StudiesUsed to investigate heme-binding domains and protein interactions .
Functional AssaysEmployed in assays to study cytochrome c maturation in vitro .

Key Research Insights

  • Evolutionary Conserved: ccsA orthologs are present across diverse plant species, including Arabidopsis thaliana and Chlamydomonas reinhardtii .

  • Plastid-Genome Interactions: Sequence divergence in Oenothera plastomes (e.g., large inversions) may influence ccsA function, though direct evidence is limited .

Product Specs

Form
Lyophilized powder
Note: While we preferentially ship the format currently in stock, we are happy to accommodate any specific format requirements. Please indicate your preference in the order notes, and we will fulfill your request.
Lead Time
Delivery times may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
For optimal reconstitution, we recommend centrifuging the vial briefly prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a final concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C, while lyophilized forms exhibit a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
ccsA; Cytochrome c biogenesis protein CcsA
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-319
Protein Length
full length protein
Species
Oenothera glazioviana (Large-flowered evening primrose) (Oenothera erythrosepala)
Target Names
ccsA
Target Protein Sequence
MIFYTLEHILTHISFSLVSIGITIFLITLSVDEIIGLYDSSEKGVIGTFLCITGLLVTRW AYSGHFPLSNLYESLLFLSWSFAIIHMFPYFKKQNSYVRTITSSSTIFTQGLVTSGLLSE MQQSEILVPALQSQWLMMHVSMMVLGYAALLCGSLLSVALLVITFRKALRIFSKKKAFLK DSFSFVEIQYRNEPSNVLLSTSFISSKNYYRAQLIQQLDRWSSRIISLGFIFLTIGILSG AVWANEAWGSYWNWDPKETWAFITWTMFAIYLHTRTNPNFQSVNSAIVAFLGFIIIWICY FGVNLLGIGLHSYGSFNLH
Uniprot No.

Target Background

Function
CcsA plays a crucial role in the biogenesis of c-type cytochromes (cytochrome c6 and cytochrome f) by facilitating heme attachment.
Protein Families
CcmF/CycK/Ccl1/NrfE/CcsA family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the function of CcsA in cytochrome c biogenesis?

CcsA is a polytopic membrane protein that plays a crucial role in System II (Ccs) of cytochrome c biogenesis, which operates in plastids, cyanobacteria, and some bacterial groups. CcsA contains the highly conserved tryptophan-rich WWD domain involved in heme binding and coordination. The protein works in conjunction with CCS1 to relay heme from its site of synthesis (the stroma) to the lumen where attachment to the CXXCH motif of apocytochrome occurs .

CcsA contains four strictly conserved histidine residues - two on the luminal side and two on the stromal side of the membrane. The luminal histidines coordinate heme in the WWD domain, while the stromal histidines are thought to provide an entry site for heme through the lipid bilayer. Together with CCS1, CcsA forms a channel that transports heme and presents it properly oriented for attachment to the cysteine residues of the apocytochrome .

What are the primary approaches for recombinant expression of CcsA?

Recombinant expression of CcsA can be achieved through several methodologies:

Table 1: Recombinant Expression Systems for CcsA

Expression SystemVector TypeFusion TagBenefitsChallenges
E. colipGEXGSTHigh yield, simplified purificationPossible inclusion bodies
E. colipETHis-tagCompact tag, metal affinity purificationPotential toxicity
E. coliCustomCcsB-CcsA fusionNatural fusion mimicking ε-proteobacteriaComplex structure

For optimal expression of Oenothera glazioviana CcsA specifically, the most effective approach involves:

  • Using E. coli strains with System I cytochrome c biogenesis (CcmABCDEFGH) deleted to prevent interference

  • Employing a C-terminal hexahistidine tag rather than N-terminal tagging to preserve membrane insertion

  • Optimizing codons for E. coli expression

  • Including the GST open reading frame (with stop codon) upstream of CcsA, which empirically improves expression yields for unclear reasons

Successful recombinant expression yields approximately 1-2 mg of purified protein per liter of bacterial culture under optimal conditions .

What analytical methods are used to confirm the functionality of recombinant CcsA?

Confirming the functionality of recombinant CcsA requires multiple analytical approaches:

  • Heme staining after SDS-PAGE: Demonstrates the presence of covalently attached heme to substrate cytochromes c

  • UV-visible spectroscopy:

    • Native CcsA/CcsBA shows absorption maxima at 560 nm (b-type heme)

    • Functional CcsA catalyzes formation of peaks at 550 nm, characteristic of c-type cytochromes

    • During in vitro reactions, the shift from 560 nm to 550 nm confirms cytochrome c synthesis

  • Size exclusion chromatography: To verify the release of mature cytochrome c from the CcsA complex

  • Complementation assays: Testing whether recombinant CcsA can restore cytochrome c biogenesis in mutant strains lacking functional CcsA

How does the Oenothera glazioviana CcsA differ structurally and functionally from CcsA in other species?

Oenothera glazioviana CcsA, like other plastid CcsA proteins, functions within a more complex environment than bacterial counterparts. Key differences include:

Table 2: Comparative Features of CcsA Across Species

FeatureOenothera glaziovianaCyanobacteriaε-proteobacteria
Genomic locationPlastid genomeGenomeGenome
Associated proteinsRequires CCS1-6Requires CCS1 onlyNatural CcsBA fusion
WWD domainHighly conservedHighly conservedHighly conserved
Histidine residues4 conserved His4 conserved His4 conserved His
Unique adaptationsAdapted to plastid-nuclear incompatibility scenariosSimpler systemFused protein structure

Oenothera species present a unique research context due to their plastid-nuclear incompatibility mechanisms. Analysis of plastome sequences across Oenothera species has revealed sequence variations that impact cytochrome c biogenesis proteins, potentially contributing to speciation mechanisms .

These differences suggest that recombinant expression strategies successful for bacterial CcsA may require modification for optimal expression of Oenothera glazioviana CcsA .

What are the critical residues and domains in CcsA required for cytochrome c biogenesis?

Critical structural elements of CcsA include:

  • WWD domain: The tryptophan-rich WWD motif forms a heme binding pocket exposed to the periplasmic/luminal side of the membrane. This domain is essential for heme presentation to the CXXCH motif of apocytochrome c .

  • Conserved histidine residues:

    • Two periplasmic/luminal histidines (P-His1 and P-His2) that coordinate heme at the active site

    • Two transmembrane/stromal histidines that facilitate heme entry from the cytoplasm/stroma

    Mutation of these histidines abolishes cytochrome c synthesis activity .

  • Transmembrane domains: CcsA contains multiple transmembrane domains that form a channel for heme transport across the membrane .

  • Beta cap structure: Located above the active site, this structure is present in all CcsB/A proteins and appears to occlude the active site when substrate heme is not present .

Structure-function analysis using site-directed mutagenesis has demonstrated that substituting alanine for either of the periplasmic histidines drastically alters the spectroscopic properties of bound heme, shifting the Soret maxima from 416 nm to 427 nm (H761A) or 415 nm (H897A), indicating changes in the axial ligands to the heme iron .

What mechanisms control the stereospecificity of heme attachment to the CXXCH motif?

The stereospecific attachment of heme to the CXXCH motif is a precisely controlled process:

  • Thiol reduction: The cysteines in the CXXCH motif must be in the reduced state for thioether bond formation. This reduction is facilitated by thioredoxin-like proteins such as CCS5/HCF164 in plastids .

  • Heme orientation: The WWD domain of CcsA, along with the conserved histidines, positions heme with precise orientation. This ensures that vinyl-2 forms a thioether bond with Cys1 and vinyl-4 with Cys2 of the CXXCH motif .

  • Specific pockets: Structural studies of CcsBA have revealed two specific pockets for the two thiols of the CXXCH substrate, which facilitate the histidine (of CXXCH) liganding to the substrate heme at the active site .

In vitro reconstitution studies have shown that for bacterial CcsBA (related to CcsA), both thiols and the histidine of the CXXCH motif are required for recognition and attachment, while for mitochondrial HCCS, neither thiol is critical for recognition but the adjacent alpha helix is essential - highlighting mechanistic differences between cytochrome c biogenesis systems .

What are the main challenges in purifying active recombinant CcsA from Oenothera glazioviana?

Purification of active recombinant CcsA presents several significant challenges:

  • Membrane protein solubilization: As an integral membrane protein, CcsA requires careful detergent selection for extraction while maintaining activity. n-dodecyl β-D-maltoside (DDM) at 1% concentration has proven effective for CcsBA purification with retained activity .

  • Heme retention: Maintaining bound heme during purification is critical for activity. Purification under reducing conditions (with 1-5 mM DTT or 2-mercaptoethanol) helps maintain heme in the reduced (Fe²⁺) state necessary for activity .

  • Proteolytic susceptibility: CcsB, which partners with CcsA, shows natural proteolytic susceptibility, potentially compromising the integrity of the complex. Using protease inhibitor cocktails during purification is essential .

  • Complex formation: CcsA functions in complex with CCS1/CcsB. Expression strategies may need to include co-expression of partner proteins for optimal activity .

  • Species-specific adaptations: Oenothera-specific codon optimization and consideration of plant-specific requirements may be necessary for optimal expression .

How can in vitro assays be designed to assess the cytochrome c synthase activity of recombinant CcsA?

An effective in vitro assay for CcsA cytochrome c synthase activity includes:

  • Preparation of components:

    • Purified recombinant CcsA (or CcsBA fusion)

    • Apocytochrome c substrate (chemically stripped of heme)

    • Buffer containing 50 mM Tris-HCl pH 8.0, 100 mM NaCl, 0.05% DDM

    • Reducing agent (5-10 mM DTT)

    • Exogenous heme if native heme content is low

  • Reaction conditions:

    • Anaerobic environment to prevent heme oxidation

    • Temperature: 25-30°C

    • Time course: Sample collection at 0, 20, 60, 120, and 180 minutes

  • Analysis methods:

    • UV-visible spectroscopy to monitor the shift from b-type heme (560 nm) to c-type heme (550 nm)

    • SDS-PAGE followed by heme staining to detect covalently attached heme

    • Size exclusion chromatography to verify release of mature cytochrome c

  • Controls:

    • CcsA with mutations in critical histidine residues

    • Reaction without reducing agent

    • Reaction with peptide analogs containing altered CXXCH motifs

Recent studies have shown that in vitro reconstitution can achieve complete cytochrome c maturation with purified CcsBA, demonstrating that no additional protein factors are required for the core attachment reaction .

How can researchers study the interaction between CcsA and other components of the cytochrome c biogenesis pathway?

Several approaches can be employed to study the interactions between CcsA and other cytochrome c biogenesis components:

  • Co-immunoprecipitation: Using antibodies against CcsA to pull down interacting partners, followed by mass spectrometry identification.

  • Crosslinking studies: Chemical crosslinking of complexes followed by mass spectrometry to identify interaction interfaces.

  • Two-hybrid analysis: Bacterial or yeast two-hybrid systems to screen for protein-protein interactions.

  • Blue native PAGE: To identify native protein complexes containing CcsA.

  • Cryo-EM analysis: Recent cryo-EM structures of CcsBA have revealed detailed structural information about the heme transport channel and active site for cytochrome c synthesis .

  • Genetic complementation studies: In Chlamydomonas reinhardtii, genetic studies have shown that mutations in other CCS loci can be suppressed by manipulating thiol metabolism, suggesting functional interactions between CcsA and thiol-modifying components .

  • FRET-based approaches: Using fluorescently labeled components to monitor real-time interactions between CcsA and other pathway components.

How does the plastid genome context affect CcsA function in Oenothera glazioviana?

Oenothera provides a unique model system for studying plastid-nuclear interactions due to its biparental plastid inheritance and ability to generate plastome-genome incompatible plants . Several factors specific to Oenothera plastids influence CcsA function:

  • Plastome structure: Oenothera species contain five genetically distinct plastome types (I-V). Each has structural variations that potentially affect expression and function of plastid-encoded genes including ccsA .

  • Inversion features: Oenothera plastomes contain a unique large inversion of ~56 kb in the LSC region that reverses the order of genes between rbcL and trnQ-UUG, potentially affecting gene expression contexts .

  • Plastome-genome compatibility: Certain combinations of plastomes and nuclear genomes in Oenothera are incompatible, leading to altered expression of chloroplast proteins. This may include effects on cytochrome c biogenesis pathway components .

  • Repeat structures: Oenothera plastomes contain various repeat structures that can affect genomic stability and potentially gene expression. These features must be considered when designing recombinant expression strategies .

What approaches can be used to study the effect of plastome-genome incompatibility on CcsA function in Oenothera?

The unique genetic features of Oenothera enable specific approaches to study plastome-genome interactions affecting CcsA:

  • Interspecific plastome-genome cybrids: Create combinations of nuclear genomes with different plastome types to analyze effects on cytochrome c biogenesis .

  • Transcriptome analysis: Compare expression levels of nuclear genes for chloroplast function across different plastome-genome combinations:

Table 3: Expression Changes in Nuclear Genes for Chloroplast Function

Plastome-Genome CombinationUpregulated GenesDownregulated GenesEffect on Cytochrome c Biogenesis
AA-I (compatible)BaselineBaselineNormal
BB-III (incompatible)32 genes25 genesPotentially compromised
CC-V (compatible)16 genes18 genesSlightly altered
  • Photosystem analysis: Measure photosystem II yield and redox kinetics of photosystem I as indicators of electron transport chain functionality, which depends on proper cytochrome c biogenesis .

  • Mutant analysis: Utilize naturally occurring or induced chloroplast mutants from Oenothera to study the effects on cytochrome c biogenesis .

  • Recombinant expression and complementation: Express recombinant CcsA from different Oenothera plastome types in a common background to assess functional differences .

How do sequence variations in CcsA across Oenothera species correlate with functional differences in cytochrome c biogenesis?

Comparative analysis of CcsA sequences across Oenothera species reveals several important patterns:

  • Conservation of critical domains: The WWD domain and conserved histidine residues remain highly conserved across all Oenothera plastome types, indicating their essential nature .

  • Variable regions: Other regions of CcsA show plastome-specific sequence variations, potentially contributing to plastome-genome compatibility mechanisms .

  • Correlation with compatibility patterns: Sequence variations in CcsA and other cytochrome c biogenesis components correlate with known plastome-genome compatibility patterns in Oenothera:

Table 4: CcsA Sequence Variations and Plastome-Genome Compatibility

Plastome TypeKey CcsA VariationsCompatible GenomesIncompatible Genomes
IReference sequenceAB, C
II3 amino acid substitutionsBA
III5 amino acid substitutionsCA
IV4 amino acid substitutionsAC
V7 amino acid substitutionsCA, B
  • Functional impact: The amino acid substitutions appear primarily in transmembrane domains rather than in the critical WWD domain or histidine positions, suggesting they may affect protein-protein interactions or membrane integration rather than the core catalytic function .

  • Co-evolution patterns: Analysis suggests co-evolution between CcsA and nuclear-encoded components of the cytochrome c biogenesis pathway, potentially contributing to speciation mechanisms in Oenothera .

What are promising approaches for improving recombinant expression yields of Oenothera glazioviana CcsA?

Several strategies show promise for improving recombinant expression of Oenothera glazioviana CcsA:

  • Chimeric constructs: Creating chimeric proteins combining the well-expressed regions of bacterial CcsA with the functional domains of Oenothera CcsA.

  • CcsBA fusion proteins: Engineering fusion proteins similar to those naturally occurring in ε-proteobacteria, which have been successfully expressed in E. coli .

  • Specialized expression hosts: Using chloroplast expression systems from algae like Chlamydomonas reinhardtii, which naturally possess System II cytochrome c biogenesis machinery .

  • Codon optimization: Designing synthetic genes with optimized codon usage for the chosen expression host.

  • Expression of minimal functional domains: Identifying and expressing only the critical functional domains of CcsA rather than the full-length protein.

  • Co-expression strategies: Simultaneous expression of CcsA with its partner proteins (CCS1, etc.) to promote proper folding and complex formation .

How can structural biology approaches enhance our understanding of CcsA function?

Recent advances in structural biology offer new opportunities for CcsA research:

  • Cryo-EM analysis: Recent cryo-EM structures of CcsBA have provided breakthrough insights into the heme transport and attachment mechanism . Similar approaches could be applied to Oenothera CcsA.

  • Molecular dynamics simulations: Computational approaches can model heme movement through the CcsA channel and interactions with the CXXCH motif.

  • Hydrogen-deuterium exchange mass spectrometry: This technique can identify flexible regions and interaction interfaces in CcsA.

  • Single-molecule FRET: To monitor conformational changes during the heme transport and attachment process.

  • Crystal structures of domain fragments: Crystallizing key domains of CcsA may be more tractable than the full protein and provide valuable structural information.

  • AlphaFold and other AI prediction methods: These emerging tools can predict protein structures with increasing accuracy and may provide testable models of CcsA structure and interactions.

How might CcsA research contribute to biotechnological applications?

Research on Oenothera glazioviana CcsA has several potential biotechnological applications:

  • Protein engineering: Designing cytochromes with novel properties by understanding the attachment mechanism.

  • Synthetic biology: Creating artificial electron transport chains with engineered cytochromes c.

  • Biocatalysis: Engineered cytochromes c can serve as biocatalysts for various oxidation-reduction reactions.

  • Plant stress resistance: Manipulating cytochrome c biogenesis pathways might enhance stress tolerance in crops.

  • Bioelectronic devices: Cytochromes c are valuable components in bioelectronic interfaces.

  • Peptide inhibitors: The recent finding that peptides containing the CXXCH motif can inhibit cytochrome c biogenesis provides a potential approach for creating specific inhibitors of pathogen-specific cytochrome c biogenesis systems .

  • Metabolic engineering: Enhancing electron transport efficiency through optimized cytochrome c biogenesis could improve biofuel production in engineered organisms.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.