Recombinant Oenothera glazioviana NAD (P)H-quinone oxidoreductase subunit 3, chloroplastic

Shipped with Ice Packs
In Stock

Description

General Information

  • Name: NAD(P)H-quinone oxidoreductase subunit 3, chloroplastic

  • Source Organism: Oenothera glazioviana (Large-flowered evening primrose)

  • Location: Chloroplast

  • Function: Part of the NAD(P)H-quinone oxidoreductase complex, catalyzing the reduction of quinones .

  • Alternative names: NAD(P)H dehydrogenase subunit 3, NADH-plastoquinone oxidoreductase subunit 3

  • Gene Name: ndhC

Molecular Properties

The recombinant protein is produced with a specific tag, which is determined during the production process . It is supplied in a Tris-based buffer with 50% glycerol, optimized for protein stability . The recommended storage condition is at -20℃, with the advice to avoid repeated freezing and thawing . Short-term storage of working aliquots at 4℃ for up to one week is acceptable . The protein sequence consists of 120 amino acids .

Biological Role and Function

NAD(P)H-quinone oxidoreductases (NQOs) are flavoproteins that catalyze the two-electron reduction of quinones to hydroquinones, utilizing either NADH or NADPH as cofactors . This enzymatic activity prevents the formation of reactive oxygen species that arise from one-electron reduction of quinones .

In plants, these enzymes are essential components of the photosynthetic electron transport chain within chloroplasts . Specifically, subunit 3 is part of the larger NAD(P)H dehydrogenase complex, which is involved in cyclic electron flow around photosystem I, protecting the photosynthetic apparatus from damage and modulating the redox state of the plastoquinone pool .

Applications in Research

Recombinant Oenothera glazioviana NAD(P)H-quinone oxidoreductase subunit 3, chloroplastic, is used in various research applications, including:

  • Enzyme-Linked Immunosorbent Assays (ELISA): It can be employed as an antigen in ELISA assays for detecting and quantifying antibodies against Oenothera glazioviana proteins .

  • Protein-Protein Interaction Studies: Useful in identifying interacting partners and understanding the assembly and regulation of the NAD(P)H dehydrogenase complex .

  • Functional Studies: Facilitates investigation into the enzyme's catalytic mechanism, substrate specificity, and response to inhibitors .

Stress Response

Oenothera glazioviana seedlings respond to copper (Cu) stress by altering the expression of proteins, including those involved in oxidoreduction processes . Studies have identified proteins related to oxidoreduction that are differentially expressed under Cu stress conditions, suggesting their involvement in the plant's defense mechanisms .

Related enzymes

The NAD(P)H:quinone oxidoreductase (NQO) gene family consists of multiple genes encoding cytosolic flavoenzymes that catalyze the two-electron reduction of quinones to hydroquinones .

Genetic Diversity

Isozyme data from Oenothera wolfii and Oenothera glazioviana revealed genetic differences between the species . Oenothera wolfii had greater variation and more alleles per locus compared to Oenothera glazioviana .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
Tag type is finalized during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
ndhC; NAD(PH-quinone oxidoreductase subunit 3, chloroplastic; NAD(PH dehydrogenase subunit 3; NADH-plastoquinone oxidoreductase subunit 3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-120
Protein Length
full length protein
Species
Oenothera glazioviana (Large-flowered evening primrose) (Oenothera erythrosepala)
Target Names
ndhC
Target Protein Sequence
MFLLYEYDIFWAFLIISSVIPILAFRISGLLAPTSIGPEKLSSYESGIEPMGDAWLQFRI RYYMFALVFVVFDVETIFLYPWALSFDILGVSVFIEALIFVLILVLGLVYAWRKGALEWS
Uniprot No.

Target Background

Function

NDH functions as an electron shuttle, transferring electrons from NAD(P)H:plastoquinone, via FMN and iron-sulfur (Fe-S) centers, to quinones within the photosynthetic electron transport chain and potentially the chloroplast respiratory chain. In this species, the primary electron acceptor is believed to be plastoquinone. The enzyme couples this redox reaction to proton translocation, thus conserving redox energy as a proton gradient.

Protein Families
Complex I subunit 3 family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is NAD(P)H-quinone oxidoreductase subunit 3 and what is its function in chloroplasts?

NAD(P)H-quinone oxidoreductase subunit 3 (ndhC) is a key component of the chloroplastic NAD(P)H dehydrogenase complex, which catalyzes the reduction of quinones using NAD(P)H as an electron donor. This enzyme plays a crucial role in the cyclic electron transport chain in chloroplasts, contributing to ATP synthesis without net NADPH production. The ndhC subunit specifically contributes to the membrane domain of the complex and is essential for proper assembly and function of the entire NAD(P)H dehydrogenase complex .

Functionally, this enzyme catalyzes the two-electron reduction of quinones to the more stable and less mutagenic quinols, which represents an important detoxification mechanism within the chloroplast . The reaction can be represented as:

NAD(P)H+H++QuinoneNAD(P)++Quinol\text{NAD(P)H} + \text{H}^+ + \text{Quinone} \rightarrow \text{NAD(P)}^+ + \text{Quinol}

What are the optimal storage conditions and handling procedures for this recombinant protein?

For optimal stability and retention of activity, the following storage and handling protocols are recommended:

FormRecommended Storage TemperatureShelf Life
Liquid-20°C/-80°C6 months
Lyophilized-20°C/-80°C12 months

Handling recommendations:

  • Briefly centrifuge vials prior to opening to ensure contents are at the bottom

  • Avoid repeated freeze-thaw cycles

  • Store working aliquots at 4°C for up to one week

  • For extended storage, aliquot and maintain at -20°C or -80°C

What is the recommended reconstitution protocol for the lyophilized form?

For optimal reconstitution of the lyophilized protein:

  • Centrifuge the vial briefly before opening

  • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% (recommended default: 50%)

  • Aliquot into smaller volumes to minimize freeze-thaw cycles

  • Store reconstituted protein at -20°C/-80°C for long-term storage

This approach helps maintain protein stability and enzymatic activity while reducing potential degradation from repeated freeze-thaw cycles.

How can researchers effectively measure the enzymatic activity of NAD(P)H-quinone oxidoreductase?

The enzymatic activity of NAD(P)H-quinone oxidoreductase can be measured through spectrophotometric assays that monitor the oxidation of NAD(P)H at 340 nm. A standard protocol based on related NAD(P)H quinone oxidoreductases includes:

  • Reaction mixture preparation:

    • 50 µM quinone substrate

    • 500 µM NAD(P)H

    • 10 µg to 0.1 µg enzyme (concentration dependent on specific activity)

    • 20 mM Tris-HCl pH 8

    • 100 mM NaCl

    • 5% (v/v) DMSO

  • Measurement procedure:

    • Use UV-transparent 96-well plates

    • Set plate reader to monitor absorbance at 340 nm

    • Initiate reactions by adding enzyme and NAD(P)H to quinone

    • Include enzyme-free controls

    • Determine rates by fitting the change in optical density

Researchers should ensure that NAD(P)H concentrations remain within the linear range of the plate reader and maintain a greater than 5:1 molar ratio of NAD(P)H to quinone for reliable kinetic measurements.

How does protein mobility and conformational dynamics affect the function of NAD(P)H-quinone oxidoreductases?

Recent research on NAD(P)H quinone oxidoreductases indicates that protein mobility and conformational dynamics significantly influence enzyme function. Key findings include:

  • Negative cooperativity: Evidence suggests that quinone oxidoreductases exhibit negative cooperativity, which is likely mediated by alterations in protein mobility. This involves communication between the enzyme's active sites through conformational changes .

  • Structural communication: Crystal structures of related enzymes in complex with inhibitors like dicoumarol show both active sites occupied, but provide limited information about conformational changes enabling communication between sites. Studies of the yeast quinone oxidoreductase Lot6p suggest that communication is mediated by alterations in protein mobility, particularly through an α-helix near the binding site .

  • Long-range allosteric networks: NMR studies and mutagenesis analyses have revealed long-range communication of conformational and dynamic information between distal functional sites in related enzymes. This suggests the existence of allosteric networks that can be perturbed by mutations .

For researchers studying Oenothera glazioviana NAD(P)H-quinone oxidoreductase, considering these dynamic aspects may provide insights into substrate binding, catalytic efficiency, and regulation mechanisms.

How can researchers effectively compare the catalytic efficiency of plant chloroplastic NAD(P)H-quinone oxidoreductases versus mammalian NQO enzymes?

To effectively compare plant chloroplastic NAD(P)H-quinone oxidoreductases with mammalian NQO enzymes, researchers should consider several methodological approaches:

  • Kinetic parameter determination: Measure and compare:

    • K₍ₘ₎ values for various substrates

    • V₍ₘₐₓ₎ and k₍cat₎ values

    • Catalytic efficiency (k₍cat₎/K₍ₘ₎) across different substrates

  • Redox potential analysis: Determine the redox potential of the FMN group, as this significantly affects the enzyme's ability to reduce various quinones. Different quinone oxidoreductases show varying reduction rates partly due to differences in the redox potential of their flavin groups .

  • Structural comparison:

    • Analyze active site architecture and substrate binding pockets

    • Compare the size and chemical properties of the active sites

    • Evaluate the presence of conserved residues involved in catalysis

  • Substrate panel testing: Test both enzyme types with identical panels of substrates under standardized conditions to directly compare substrate preferences and catalytic efficiencies .

  • Inhibitor profiling: Examine the response to common inhibitors like dicoumarol and related compounds, which can provide insights into structural and functional differences .

This comparative approach will help elucidate the evolutionary adaptations of these enzymes to their respective cellular environments and physiological roles.

What strategies can be employed to improve the stability and activity of recombinant NAD(P)H-quinone oxidoreductase for extended experimental applications?

Based on research with related enzymes, several strategies can be implemented to enhance stability and activity:

  • Buffer optimization:

    • Test various buffer compositions (HEPES, phosphate, Tris)

    • Optimize pH range (typically 7.5-8.5)

    • Evaluate the effect of ionic strength

  • Protein engineering approaches:

    • Targeted mutations based on comparative analysis of more stable orthologs

    • Introduction of stabilizing mutations at flexible regions

    • Consider suppressor mutations identified in related enzymes (e.g., p.H80R and p.E247Q in human NQO1)

  • Co-factor stabilization:

    • Ensure sufficient FAD availability in storage and reaction buffers

    • Consider pre-incubation with FAD to maximize holo-enzyme formation

  • Formulation additives:

    • Use of glycerol (20-50%) to prevent aggregation and improve stability

    • Addition of reducing agents like DTT or β-mercaptoethanol at low concentrations

    • Testing stabilizing additives such as trehalose or sucrose

  • Storage considerations:

    • Single-use aliquots to avoid freeze-thaw cycles

    • Flash freezing in liquid nitrogen before long-term storage

    • Investigation of lyophilization conditions with appropriate cryoprotectants

Implementing these strategies can significantly extend the usable lifetime of the enzyme for research applications and improve experimental reproducibility.

What experimental approaches can researchers use to study the integration of NAD(P)H-quinone oxidoreductase subunit 3 into the complete NDH complex?

Studying the integration of NAD(P)H-quinone oxidoreductase subunit 3 into the complete NDH complex requires specialized techniques to investigate membrane protein complexes:

  • Blue native polyacrylamide gel electrophoresis (BN-PAGE):

    • Allows separation of intact membrane protein complexes

    • Can be followed by second-dimension SDS-PAGE to identify individual subunits

    • Western blotting using antibodies against ndhC can confirm its presence in complexes

  • Co-immunoprecipitation studies:

    • Using antibodies against ndhC or other NDH complex components

    • Identifying interaction partners through mass spectrometry analysis

  • Cryo-electron microscopy:

    • High-resolution structural analysis of the entire NDH complex

    • Localization of ndhC within the complex architecture

    • Visualization of potential conformational changes during enzyme function

  • Genetic approaches:

    • CRISPR/Cas9-mediated knockout or modification of the ndhC gene

    • Complementation studies with wild-type or mutant variants

    • Analysis of complex assembly in the absence or mutation of ndhC

  • Crosslinking mass spectrometry:

    • Chemical crosslinking of assembled complexes

    • Mass spectrometry analysis to identify crosslinked peptides

    • Determination of spatial proximity relationships between subunits

These approaches provide complementary information about the structural organization, assembly process, and functional integration of ndhC within the NDH complex.

What are common challenges in working with recombinant chloroplastic membrane proteins and how can they be addressed?

Researchers working with recombinant chloroplastic membrane proteins like NAD(P)H-quinone oxidoreductase subunit 3 often encounter several technical challenges:

ChallengePotential Solutions
Low expression yields- Optimize codon usage for the expression host
- Test different expression systems (bacterial, yeast, insect cells)
- Use fusion tags to improve solubility
- Optimize induction conditions (temperature, time, inducer concentration)
Protein aggregation- Express at lower temperatures (15-18°C)
- Add solubilizing agents during extraction
- Use detergents appropriate for membrane proteins
- Consider extraction as a fusion with soluble partners
Loss of cofactors- Supplement expression media with riboflavin
- Add FAD during purification steps
- Include FAD in storage buffers
Limited stability- Optimize buffer conditions (pH, salt, additives)
- Store with glycerol (20-50%)
- Prepare single-use aliquots
- Consider lyophilization for long-term storage
Reconstitution difficulties- Use gentle, stepwise dilution to avoid precipitation
- Test different detergents for solubilization
- Consider incorporation into nanodiscs or liposomes for functional studies
Activity assessment- Ensure proper cofactor incorporation
- Test multiple substrate types
- Optimize assay conditions (pH, temperature, ionic strength)
- Include appropriate positive controls

Understanding these challenges and implementing appropriate mitigation strategies can significantly improve experimental outcomes when working with this challenging class of proteins.

How can researchers distinguish between enzymatic and non-enzymatic reactions when measuring quinone reduction?

Accurately distinguishing between enzymatic and non-enzymatic quinone reduction is crucial for obtaining reliable activity measurements. Recommended approaches include:

  • Comprehensive controls:

    • No-enzyme controls to measure background reduction rates

    • Heat-inactivated enzyme controls (boil enzyme for 10 minutes)

    • Controls with known inhibitors of NAD(P)H quinone oxidoreductases

  • Kinetic analysis:

    • Enzymatic reactions typically show saturation kinetics following Michaelis-Menten model

    • Non-enzymatic reactions often show linear relationship with substrate concentration

    • Measure initial rates at multiple substrate concentrations to differentiate

  • Inhibitor studies:

    • Use specific inhibitors like dicoumarol

    • Construct inhibition curves and determine IC₅₀ values

    • Compare with known inhibition profiles of related enzymes

  • Spectroscopic differentiation:

    • Monitor multiple wavelengths simultaneously

    • Analyze spectral changes characteristic of enzymatic vs. non-enzymatic processes

    • Consider fluorescence-based assays as alternative approaches

  • Temperature and pH dependence:

    • Enzymatic reactions show characteristic temperature and pH optima

    • Compare reaction rates across temperature and pH ranges

    • Non-enzymatic reactions often show different temperature dependence profiles

  • Oxygen dependence:

    • Compare rates under aerobic vs. anaerobic conditions

    • Enzymatic two-electron reduction is often less affected by oxygen

    • One-electron non-enzymatic reduction is typically oxygen-sensitive

Implementing these approaches allows researchers to confidently attribute measured activity to the enzyme rather than to non-specific reactions.

What are promising research directions for understanding the role of NAD(P)H-quinone oxidoreductase in plant stress responses and adaptation?

Several promising research directions for understanding the role of NAD(P)H-quinone oxidoreductase in plant stress responses include:

  • Oxidative stress responses:

    • Investigate how expression and activity levels change under various oxidative stress conditions

    • Determine the role in detoxifying reactive oxygen species (ROS) during stress

    • Analyze the protective effect against quinone toxicity in chloroplasts

  • Integration with photosynthetic electron transport:

    • Explore the contribution to alternative electron transport pathways during stress

    • Investigate the role in balancing ATP/NADPH ratios under fluctuating light conditions

    • Study the interaction with other components of cyclic electron flow

  • Comparative genomics and adaptation:

    • Compare sequence and functional variations across plant species from different environments

    • Identify adaptive changes in plants from high-stress environments

    • Correlate structural variations with functional adaptations to specific stresses

  • Regulatory networks:

    • Identify transcriptional and post-translational regulation mechanisms

    • Map signaling pathways controlling enzyme expression and activity

    • Characterize protein-protein interactions that modulate function during stress

  • Biotechnological applications:

    • Explore potential for engineering enhanced stress tolerance in crops

    • Investigate the use of modified enzymes for improved photosynthetic efficiency

    • Develop biosensors for detecting quinone-generating stresses in plants

These research directions would provide valuable insights into the physiological roles of this enzyme in plant adaptation and could lead to applications in crop improvement for stress resilience.

How might structural and functional studies of NAD(P)H-quinone oxidoreductase contribute to developing new biocatalysts or biotechnological applications?

The structural and functional understanding of NAD(P)H-quinone oxidoreductase presents several opportunities for biotechnological applications:

  • Engineered biocatalysts:

    • Development of enzymes with enhanced catalytic efficiency for specific substrates

    • Creation of variants with improved stability for industrial applications

    • Engineering of altered substrate specificity for targeted chemical transformations

  • Bioremediation applications:

    • Utilization in detoxification of quinone-containing environmental pollutants

    • Development of enzyme-based systems for treatment of contaminated soils or waters

    • Creation of biosensors for detecting toxic quinones in environmental samples

  • Pharmaceutical applications:

    • Exploitation of the two-electron reduction mechanism for prodrug activation

    • Development of enzyme-based drug delivery systems

    • Screening platform for identifying new quinone-based therapeutic compounds

  • Synthetic biology tools:

    • Integration into artificial electron transport chains

    • Development of redox-sensing cellular systems

    • Creation of novel metabolic pathways for production of valuable compounds

  • Structural insights for drug design:

    • Use of active site architecture to design specific inhibitors or activators

    • Development of molecules targeting related human enzymes based on structural comparisons

    • Creation of chimeric enzymes with novel functions based on domain swapping

These applications would leverage the fundamental understanding of NAD(P)H-quinone oxidoreductase structure and function to address practical challenges in biotechnology, environmental science, and medicine.

What are the key considerations for researchers designing experiments with Recombinant Oenothera glazioviana NAD(P)H-quinone oxidoreductase subunit 3?

Researchers designing experiments with this enzyme should consider:

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.