Recombinant Oenothera glazioviana NAD (P)H-quinone oxidoreductase subunit 4L, chloroplastic

Shipped with Ice Packs
In Stock

Description

Production and Purification

Expression Systems

Host OrganismTagExpression RegionPurityReference
E. coliHis1–101 aa (Full)>95%
BaculovirusUndeterminedPartial>85%

Key Features

  • Storage Buffer: Tris-based buffer with 50% glycerol

  • Storage Conditions: -20°C/-80°C (extended) or 4°C (short-term aliquots)

Biological and Functional Insights

Role in Photosynthesis
The NDH complex mediates cyclic electron transport (CET) in chloroplasts, enhancing photoprotection and ATP synthesis under stress conditions. Subunit 4L is critical for structural integrity and electron transfer between NAD(P)H and quinones .

Functional Interactions

  • Electron Transport: Facilitates redox reactions in thylakoid membranes

  • Stress Adaptation: Contributes to reactive oxygen species (ROS) scavenging during photoinhibition

Research Applications

Experimental Uses

ApplicationDescriptionSource
ELISADetection of NAD(P)H-quinone oxidoreductase activity in plant extracts
Biochemical AssaysStudy of electron transfer kinetics and NDH complex assembly
Structural StudiesCrystallization for X-ray diffraction analysis
  • Avoid repeated freeze-thaw cycles

  • Reconstitute in deionized water (0.1–1.0 mg/mL) with glycerol (5–50%) for long-term storage

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format that we currently have in stock. However, if you have a specific format requirement, please indicate it in your order notes. We will prepare your order according to your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery times, please consult your local distributors.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by several factors, including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
ndhE; NAD(PH-quinone oxidoreductase subunit 4L, chloroplastic; NAD(PH dehydrogenase subunit 4L; NADH-plastoquinone oxidoreductase subunit 4L
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-101
Protein Length
full length protein
Species
Oenothera glazioviana (Large-flowered evening primrose) (Oenothera erythrosepala)
Target Names
ndhE
Target Protein Sequence
MILEHVLVLSAYLFSIGIYGLITSRNMVRALMCLELLLNSVNLNFVTFSDFFDSRQLKGD IFSIFIIAIAAAEATIGLAIVSSIYRNRKSIRINQSNLLNK
Uniprot No.

Target Background

Function
NDH facilitates electron transfer from NAD(P)H:plastoquinone, via FMN and iron-sulfur (Fe-S) centers, to quinones in the photosynthetic chain and potentially in a chloroplast respiratory chain. In this species, the immediate electron acceptor for the enzyme is thought to be plastoquinone. The enzyme couples the redox reaction to proton translocation, thereby conserving redox energy in a proton gradient.
Protein Families
Complex I subunit 4L family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is NAD(P)H-quinone oxidoreductase subunit 4L and what is its role in chloroplasts?

NAD(P)H-quinone oxidoreductase subunit 4L (ndhE) is a critical component of the chloroplast NAD(P)H dehydrogenase (NDH) complex, which functions in cyclic electron flow around photosystem I. This protein is encoded by the ndhE gene and is also known as NADH-plastoquinone oxidoreductase subunit 4L . The protein is 101 amino acids in length and contributes to the membrane domain of the NDH complex in chloroplasts . The NDH complex catalyzes the transfer of electrons from NAD(P)H to plastoquinone, helping maintain optimal photosynthetic efficiency especially under stress conditions. This process is essential for balancing the ATP/NADPH ratio during photosynthesis and protecting against photoinhibition.

How is the recombinant protein produced and what expression systems are used?

Recombinant Oenothera glazioviana NAD(P)H-quinone oxidoreductase subunit 4L is primarily produced using prokaryotic expression systems, particularly E. coli . The protein is typically expressed with an N-terminal His-tag to facilitate purification . Some manufacturers may also use yeast expression systems for certain applications, similar to what is used for the related ndhC subunit . The expression and purification process typically includes:

  • Cloning the full-length ndhE gene into an appropriate expression vector

  • Transformation into the expression host (E. coli)

  • Induction of protein expression

  • Cell lysis and extraction of the recombinant protein

  • Purification using affinity chromatography (via the His-tag)

  • Quality control assessment by SDS-PAGE to ensure purity >85-90%

What are the optimal storage conditions for maintaining protein stability?

The optimal storage conditions for recombinant NAD(P)H-quinone oxidoreductase subunit 4L vary depending on the formulation (liquid or lyophilized) . Based on manufacturer recommendations:

FormulationShort-term StorageLong-term StorageShelf Life
Lyophilized-20°C-80°C12 months
Liquid4°C (up to 1 week)-20°C/-80°C6 months

It is strongly recommended to avoid repeated freeze-thaw cycles as they can significantly reduce protein activity and stability . For working solutions, store aliquots at 4°C for no more than one week . The protein is typically supplied in a stabilizing buffer that contains glycerol (often 50%) to prevent degradation during freeze-thaw cycles .

How does the Oenothera glazioviana NAD(P)H-quinone oxidoreductase subunit 4L compare to homologous proteins in other plant species?

The NAD(P)H-quinone oxidoreductase subunit 4L is highly conserved across flowering plants, reflecting its essential role in photosynthetic electron transport. Oenothera glazioviana (evening primrose) is particularly interesting as a model system due to its unique genomic features and evolutionary history. Sequence alignment studies show that the ndhE gene product maintains high sequence conservation in the transmembrane domains while showing more variability in the loop regions.

Comparison of key functional regions reveals that the transmembrane helices that anchor the protein in the thylakoid membrane are nearly identical across angiosperms, while the regions involved in subunit interactions show species-specific adaptations. This conservation pattern suggests evolutionary pressure to maintain the core electron transport function while allowing flexibility in complex assembly that may reflect adaptation to different photosynthetic environments.

What experimental methods are best suited for studying NAD(P)H-quinone oxidoreductase subunit 4L function?

Several complementary approaches are recommended for comprehensive functional analysis:

  • In vitro reconstitution assays: Using purified recombinant protein to reconstitute NDH complex activity with artificial electron donors and acceptors.

  • Blue native PAGE: For studying the incorporation of the subunit into the complete NDH complex and identifying interaction partners.

  • Electron paramagnetic resonance (EPR): To track electron transfer through the complex and identify the role of subunit 4L in this process.

  • Fluorescence-based assays: Measuring cyclic electron flow activity in reconstituted systems containing NAD(P)H-quinone oxidoreductase subunit 4L.

  • Site-directed mutagenesis: Creating specific amino acid substitutions to determine structure-function relationships.

These methods can be combined with modern structural biology techniques like cryo-electron microscopy to correlate functional data with structural insights.

What is known about post-translational modifications of this protein?

While the search results don't specifically mention post-translational modifications (PTMs) of NAD(P)H-quinone oxidoreductase subunit 4L, chloroplast membrane proteins frequently undergo modifications that regulate their function, assembly, and turnover. Potential PTMs that may be relevant include:

  • Phosphorylation of serine, threonine, or tyrosine residues, which could regulate protein-protein interactions or enzyme activity

  • Acetylation or methylation of lysine residues

  • Redox modifications of cysteine residues in response to changes in chloroplast redox state

Researchers investigating PTMs should consider using mass spectrometry-based proteomics approaches, combined with specific enrichment strategies for the modification of interest. Western blotting with modification-specific antibodies can also be used to detect common PTMs if available.

How should recombinant NAD(P)H-quinone oxidoreductase subunit 4L be reconstituted for experimental use?

Proper reconstitution is critical for maintaining protein activity. The recommended protocol based on manufacturer guidelines is as follows:

  • Briefly centrifuge the vial containing lyophilized protein before opening to ensure all material is at the bottom .

  • Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL .

  • For long-term storage, add glycerol to a final concentration of 5-50% (50% is commonly recommended) .

  • Aliquot the reconstituted protein to minimize freeze-thaw cycles .

  • Store working aliquots at 4°C for up to one week; store remaining aliquots at -20°C or -80°C .

For membrane proteins like NAD(P)H-quinone oxidoreductase subunit 4L, inclusion of appropriate detergents or lipids may be necessary to maintain native-like structure, especially for functional studies. Consider adding mild, non-ionic detergents at concentrations just above their critical micelle concentration.

What assays can be used to measure the activity of recombinant NAD(P)H-quinone oxidoreductase subunit 4L?

As part of the NDH complex, measuring the isolated activity of subunit 4L requires specialized approaches:

When designing these assays, researchers should include appropriate controls:

  • Denatured protein (negative control)

  • Commercially available NDH complex components (positive control)

  • Reactions without substrate or with inhibitors to confirm specificity

How can researchers troubleshoot issues with protein stability?

Common stability issues with membrane proteins like NAD(P)H-quinone oxidoreductase subunit 4L include aggregation, precipitation, and loss of activity. Troubleshooting approaches include:

IssuePotential CausesSolutions
Precipitation upon thawingRapid temperature change, incompatible bufferThaw slowly at 4°C, optimize buffer composition
Loss of activity over timeProteolytic degradation, oxidationAdd protease inhibitors, reduce storage temperature, add antioxidants
AggregationHydrophobic interactions, improper foldingAdd appropriate detergents, optimize ionic strength
Poor solubilityInherent hydrophobicity of membrane proteinUse mild detergents, consider lipid nanodiscs for functional studies

Protein stability can be monitored using analytical techniques such as dynamic light scattering to detect aggregation, circular dichroism to assess secondary structure, and activity assays to confirm functional integrity.

What are current research applications for recombinant NAD(P)H-quinone oxidoreductase proteins?

Current research utilizing recombinant NAD(P)H-quinone oxidoreductase proteins like subunit 4L focuses on several key areas:

  • Structural biology: Determining high-resolution structures of the complete NDH complex to understand the arrangement and interactions of individual subunits.

  • Photosynthesis efficiency: Investigating how manipulation of NDH complex components might enhance photosynthetic efficiency, particularly under stress conditions.

  • Evolutionary studies: Comparing NDH complex components across plant species to understand the evolution of photosynthetic mechanisms.

  • Bioenergetic research: Exploring the role of cyclic electron flow in maintaining optimal ATP/NADPH ratios during photosynthesis.

  • Plant stress responses: Examining how NDH complex activity changes under various environmental stresses and its role in photoprotection.

The availability of recombinant proteins like NAD(P)H-quinone oxidoreductase subunit 4L enables these studies by providing access to purified components for in vitro reconstitution and functional analysis.

How can researchers effectively study interactions between NAD(P)H-quinone oxidoreductase subunit 4L and other complex components?

Several complementary approaches are recommended for studying protein-protein interactions:

  • Co-immunoprecipitation: Using antibodies against tagged NAD(P)H-quinone oxidoreductase subunit 4L to pull down interaction partners.

  • Yeast two-hybrid or split-reporter assays: For screening potential interaction partners, though these may be challenging with membrane proteins.

  • Surface plasmon resonance (SPR): For quantitative analysis of binding kinetics between subunit 4L and other proteins.

  • Cross-linking coupled with mass spectrometry: To identify interaction interfaces at the amino acid level.

  • Förster resonance energy transfer (FRET): For studying interactions in reconstituted systems or in vivo.

These techniques can be combined with mutagenesis approaches to identify specific residues critical for protein-protein interactions within the complex.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.