Recombinant Oenothera glazioviana Photosystem II CP47 chlorophyll apoprotein (psbB)

Shipped with Ice Packs
In Stock

Description

Functional Role in Photosystem II

CP47 forms part of the PSII core, stabilizing the oxygen-evolving complex and coordinating chlorophyll molecules for energy transfer . In cyanobacteria, CP47-containing RC47 complexes (lacking CP43) associate with small Cab-like proteins (ScpC/D) and Psb28 to maintain photochemical activity under stress . The protein’s structure includes six transmembrane helices, with conserved residues critical for chlorophyll binding and PSII assembly .

3.1. Photosynthesis Studies

  • PSII Assembly: Used to study intermediate complexes in PSII biogenesis, such as the RC47 assembly in Synechocystis mutants .

  • Chloroplast Gene Regulation: Investigations into the psbB operon’s light-dependent expression in Oenothera hybrids revealed promoter-region polymorphisms affecting PSI/PSII stoichiometry .

3.2. Biotechnological Tools

  • Antigen Production: Recombinant CP47 serves as an immunogen for antibody development .

  • ELISA Kits: Commercial kits (e.g., Creative Biomart, Cusabio) utilize this protein for quantitative assays .

Production and Quality Control

The protein is expressed in E. coli, purified via affinity chromatography, and lyophilized for long-term storage. Key quality metrics include:

  • Sequence Verification: Full-length sequence (508 aa) confirmed by mass spectrometry .

  • Activity: Retains photochemical functionality, including P680⁺ reduction rates comparable to native PSII .

Key Research Findings

  • Operon Organization: The psbB operon in Populus deltoides exhibits unique RNA processing patterns, influencing PSII and cytochrome b₆f complex stoichiometry .

  • Hybrid Incompatibility: In Oenothera, a 144-bp deletion upstream of the psbB operon disrupts light-regulated transcription, causing PSI/PSII imbalance in incompatible plastid-nuclear hybrids .

Future Directions

  • Structural Biology: Cryo-EM studies to resolve CP47’s role in PSII stabilization.

  • Crop Engineering: Leveraging psbB operon insights to optimize photosynthetic efficiency in plants .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will accommodate your needs to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery details.
Note: All our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance, as additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and protein stability.
Generally, the shelf life for liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing it for your order.
Synonyms
psbB; Photosystem II CP47 reaction center protein; PSII 47 kDa protein; Protein CP-47
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-508
Protein Length
full length protein
Species
Oenothera glazioviana (Large-flowered evening primrose) (Oenothera erythrosepala)
Target Names
psbB
Target Protein Sequence
MGLPWYRVHTVVLNDPGRLLAVHIMHTALVAGWAGSMALYELAVFDPSDPVLDPMWRQGM FVIPFMTRLGITNSWGGWSITGGTVTNPGIWSYEGVAGSHILFSGLCFLAAIWHWVYWDL AIFSDERTGKPSLDLPKIFGIHLFLSGLACFGFGAFHVTGLYGPGIWVSDPYGLTGEVQP VNPAWGVEGFDPFVPGGIASHHIAAGTLGILAGLFHLSVRPPQRLYKGLRMGNIETVLSS SIAAVFFAAFVVAGTMWYGSATTPIELFGPTRYQWDQGYFQQEIYRRVGAGLAKNQSLSE AWSKIPEKLAFYDYIGNNPAKGGLFRAGSMDSGDGIAVGWLGHPIFRDKEGRELFVRRMP TFFETFPVVLVDGDGIVRADVPFRRAESKYSVEQVGVTIEFYGGELNGVSYSDPATVKKY ARRAQLGEIFELDRATLKSDGVFRSSPRGWFTFGHASFALLFFFGHIWHGARTLFRDVFA GIDPDLDTQVEFGAFQKLGDPTTRRQAV
Uniprot No.

Target Background

Function
CP47 is a component of the photosystem II (PSII) core complex. It binds chlorophyll and facilitates the primary light-induced photochemical processes in PSII. PSII is a light-driven water:plastoquinone oxidoreductase, utilizing light energy to extract electrons from H2O, generating O2 and a proton gradient that subsequently powers ATP formation.
Protein Families
PsbB/PsbC family, PsbB subfamily
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the fundamental role of the CP47 chlorophyll apoprotein in Photosystem II?

CP47 functions as one of the integral antenna proteins of the oxygen-evolving Photosystem II (PSII), responsible for efficient excitation energy transfer to the PSII reaction center. This energy transfer ultimately initiates the electron transfer cascade that drives oxygenic photosynthesis. CP47 contains 16 chlorophyll molecules whose spatial arrangement and electronic properties are crucial for light harvesting and energy transfer mechanisms . In Oenothera species, CP47 plays a particularly important role in the structural stability of PSII and contributes to species-specific photosynthetic efficiency.

How does CP47 from Oenothera glazioviana differ from CP47 in other photosynthetic organisms?

While CP47 is highly conserved across photosynthetic organisms, the Oenothera glazioviana variant contains specific amino acid substitutions that may influence its functional properties. These variations are particularly relevant in the context of plastome-genome incompatibility studies in Oenothera species. The psbB operon, which includes the psbB gene encoding CP47, has been identified as a major locus for plastome-genome incompatibility in Oenothera . This makes the O. glazioviana CP47 protein particularly interesting for studying evolutionary adaptations in photosynthetic machinery and species-specific differences in light-harvesting efficiency.

What are the optimal conditions for reconstituting and storing recombinant Oenothera glazioviana psbB protein?

For optimal reconstitution of lyophilized recombinant Oenothera glazioviana CP47 protein:

  • Centrifuge the vial briefly before opening to bring contents to the bottom

  • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% (50% is recommended) for long-term storage

  • Aliquot to avoid repeated freeze-thaw cycles

Storage recommendations:

  • Long-term storage: -20°C/-80°C in aliquots containing glycerol

  • Working aliquots: 4°C for up to one week

  • Buffer conditions: Tris-based buffer with approximately 6% trehalose at pH 8.0

Avoid repeated freeze-thaw cycles as they can significantly reduce protein activity and structural integrity.

What methodologies are most effective for analyzing CP47 chlorophyll interactions in recombinant protein samples?

For analyzing CP47-chlorophyll interactions, a multi-faceted approach yields the most comprehensive results:

  • Spectroscopic Methods:

    • Absorption spectroscopy (400-700 nm range) to characterize chlorophyll binding

    • Circular dichroism to assess protein-pigment complex formation

    • Time-resolved fluorescence to measure energy transfer dynamics

  • Quantum Mechanics/Molecular Mechanics (QM/MM) Analysis:

    • Time-dependent density functional theory with range-separated functionals has proven effective for computing excitation energies of chlorophylls in CP47

    • This approach quantifies the electrostatic effect of the protein environment on chlorophyll site energies

  • Comparative Analysis Protocol:

    • Measure excitation energy profiles in both native membrane environment and isolated protein

    • Identify the most red-shifted chlorophylls (B3 followed by B1 in recent studies)

    • Map distribution of site energies among all 16 chlorophyll molecules to understand excitation energy transfer pathways

Recent computational studies have challenged previous hypotheses about the ranking of site energies in CP47 chlorophylls, providing new insights into the energy transfer mechanisms within this protein complex .

How can researchers effectively measure the light-harvesting efficiency of recombinant CP47 protein?

To measure light-harvesting efficiency of recombinant CP47:

  • Reconstitution Protocol:

    • Incorporate the recombinant protein into liposomes or nanodiscs to mimic the native membrane environment

    • Verify proper folding using circular dichroism spectroscopy

    • Confirm chlorophyll incorporation through absorption spectroscopy

  • Efficiency Measurement Techniques:

    • Time-resolved fluorescence spectroscopy to track energy migration

    • Transient absorption spectroscopy to monitor excited state dynamics

    • Quantum yield measurements comparing photons absorbed to energy transferred

  • Comparative Analysis:

    • Benchmark against wild-type CP47 in similar conditions

    • Evaluate temperature dependence (10-30°C range) to assess energetic coupling

    • Measure in the presence of other PSII components to assess contextual functionality

A critical consideration is the proper reconstitution of the protein-pigment complex, as the excitation energies and transfer properties depend significantly on the protein's structural integrity and the precise orientation of chlorophyll molecules .

What methods are available for studying the interaction between CP47 and other components of Photosystem II?

Several complementary approaches can be used to study CP47 interactions with other PSII components:

  • Co-immunoprecipitation Studies:

    • Use antibodies against CP47 to pull down interacting partners

    • Confirm interactions through Western blotting or mass spectrometry

    • Compare interaction profiles under different light conditions to identify dynamic associations

  • Crosslinking Analysis:

    • Apply chemical crosslinkers of varying lengths to identify proximity relationships

    • MS/MS analysis of crosslinked peptides to map interaction interfaces

    • Distance constraints can inform structural models of the CP47-PSII complex

  • FRET-Based Approaches:

    • Introduce fluorescent labels at specific sites in CP47 and potential partner proteins

    • Measure Förster Resonance Energy Transfer to determine relative distances

    • Time-resolved FRET can reveal dynamics of complex formation

  • Functional Reconstitution:

    • Systematic addition of purified components to reconstitute partial PSII complexes

    • Activity measurements to assess functional coupling between components

    • Correlation between structural associations and functional outcomes

These methods can reveal not only static interactions but also dynamic relationships that change during the photosynthetic process or in response to environmental conditions .

How can researchers use recombinant Oenothera glazioviana CP47 to study plastome-genome incompatibility?

To study plastome-genome incompatibility using recombinant O. glazioviana CP47:

  • Comparative Expression System:

    • Express recombinant CP47 variants from different plastome types (I, II, III, etc.)

    • Introduce these proteins into incompatible nuclear backgrounds

    • Monitor assembly, stability, and function of the resulting PSII complexes

  • Promoter Analysis Protocol:

    • Create chimeric constructs with different promoter regions from various plastome types

    • Map transcription start sites to identify regulatory elements affected by incompatibility

    • Analyze light-dependent regulation under high light (HL) and low light (LL) conditions

  • Interaction Studies:

    • Investigate interactions with nuclear-encoded factors like sigma factors

    • Focus on regions 7 bp upstream of the -35 box where critical deletions have been identified

    • Assess binding of auxiliary proteins that may be impaired in incompatible hybrids

Research has shown that in Oenothera, a deletion affecting the psbB operon promoter causes light-dependent regulatory defects in incompatible plastome-nuclear combinations. This deletion does not affect the TATA box but resides upstream of the -35 box, suggesting impaired binding of auxiliary proteins rather than direct polymerase binding issues .

What experimental approaches can quantify the electrostatic effects of protein environment on chlorophyll excitation energies in CP47?

To quantify electrostatic effects on chlorophyll excitation energies:

  • QM/MM Computational Framework:

    • Implement time-dependent density functional theory with range-separated functionals

    • Model the complete membrane-embedded PSII dimer

    • Calculate excitation energies for all 16 chlorophylls in CP47

  • Experimental Validation Methods:

    • Site-directed mutagenesis of amino acids near chlorophyll binding sites

    • Measure absorption and emission spectra before and after mutations

    • Correlate spectral shifts with electrostatic environment changes

  • Comparative Analysis:

    • Contrast "near-native" cyanobacterial PSII models with isolated CP47

    • Identify structural elements that maintain stability in isolated samples

    • Determine which chlorophyll-protein interactions are most sensitive to extraction

Recent research has demonstrated that the ranking of site energies and identity of the most red-shifted chlorophylls (B3, followed by B1) differs from previous hypotheses, providing an alternative basis for evaluating energy transfer pathways in CP47 .

How does the psbB operon contribute to feedback regulation of photosystem components?

The psbB operon contributes to feedback regulation through several mechanisms:

  • Antisense Interaction Pathway:

    • The psbB operon transcription affects pbf1 (photosystem biogenesis factor 1) expression

    • pbf1 is transcribed from the opposite strand and involved in both PSI and PSII assembly

    • Changes in psbB operon transcription in incompatible plants alter pbf1 regulation under high light conditions

  • Regulatory Network Analysis:

    • Monitor transcript levels of psbB operon genes and other photosystem components

    • Correlate changes in the psbB operon with alterations in PSI function

    • Map the regulatory network connecting psbB operon activity to both photosystems

  • Evolutionary Conservation Assessment:

    • Compare psbB operon structure across species from cyanobacteria to higher plants

    • Analyze variability in light regulation of pbf1 transcript abundance between species

    • Identify conserved regulatory elements versus species-specific adaptations

Research on Oenothera has revealed that transcriptional misregulation of the psbB operon affects not only PSII but also PSI, likely through antisense interaction with the pbf1 mRNA or through an unknown feedback regulation mechanism .

What are common pitfalls in working with recombinant photosystem proteins, and how can they be addressed?

Common challenges when working with recombinant photosystem proteins include:

  • Protein Stability Issues:

    • Challenge: Rapid degradation during purification and storage

    • Solution: Add specific protease inhibitors, maintain low temperature (4°C), and include glycerol (30-50%) in storage buffers

    • Validation: Monitor protein integrity using SDS-PAGE before experiments

  • Loss of Chlorophyll During Processing:

    • Challenge: Chlorophyll dissociation affecting functional studies

    • Solution: Purify in dim light, include stabilizing lipids, and confirm chlorophyll:protein ratio spectrophotometrically

    • Validation: Compare absorption spectra to native protein standards

  • Improper Folding:

    • Challenge: Recombinant proteins may not achieve native conformation

    • Solution: Optimize expression conditions, use membrane-mimetic environments for refolding

    • Validation: Assess secondary structure via circular dichroism and function via fluorescence

  • Aggregation Problems:

    • Challenge: Protein aggregation reducing functional yield

    • Solution: Add non-ionic detergents at concentrations above critical micelle concentration, optimize pH and ionic strength

    • Validation: Use dynamic light scattering to confirm monodispersity

  • Functional Reconstitution Difficulties:

    • Challenge: Recombinant protein lacks activity despite structural integrity

    • Solution: Co-reconstitute with essential cofactors and partner proteins

    • Validation: Compare activity profiles with native protein complexes

Implementing these strategies can significantly improve the quality and reliability of experiments using recombinant photosystem proteins.

How can researchers effectively compare data from recombinant CP47 studies with results from native photosystem complexes?

To effectively compare recombinant CP47 data with native complex results:

  • Standardized Preparation Protocol:

    • Process both recombinant and native samples under identical buffer conditions

    • Match protein concentrations and chlorophyll:protein ratios

    • Document and account for differences in sample preparation

  • Functional Benchmarking:

    • Establish quantitative metrics for energy transfer efficiency

    • Use identical measurement parameters (temperature, light intensity, detector settings)

    • Include internal standards to normalize between experimental setups

  • Structural Validation Approach:

    • Verify protein conformation through multiple spectroscopic techniques

    • Assess chlorophyll binding sites occupation in both preparations

    • Quantify differences in specific structural parameters

  • Molecular Dynamics Analysis:

    • Conduct simulations to identify which parts of native complexes maintain stability

    • Compare with isolated recombinant protein behavior

    • Use findings to develop improved reconstitution strategies

  • Data Transformation Framework:

    • Develop mathematical models to account for systematic differences

    • Establish correlation factors between recombinant and native measurements

    • Apply these transformations consistently across data sets

Research has shown that isolated CP47 samples used in many experimental studies may have structural differences from CP47 within complete PSII complexes, affecting the interpretation of results .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.