Recombinant Oenothera parviflora Apocytochrome f (petA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
petA; Cytochrome f
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
34-318
Protein Length
Full Length of Mature Protein
Species
Oenothera parviflora (Small-flowered evening primrose) (Oenothera cruciata)
Target Names
petA
Target Protein Sequence
YPIFAQQGYENPREATGRIVCANCHLANKPVDIEVPQAVLPDTVFEAVVRIPYDRQVKQV LANGKKGGLNVGAVLILPEGFELAPPARISPEMKERIGNPSFQSYRPTKKNILVIGPVPG QKYSEITFPILSPDPATNKDVHFLKYPIYVGGNRGRGQIYPDGSKSNNTVYNATAAGIVS KIIRKEKGGYEITITDASDGRQVVDIIPSGPELLVSEGESIKLDQPLTSNPNVGGFGQGD AEVVLQDPLRVQGLLFFLASVILAQIFLVLKKKQFEKVQLSEMNF
Uniprot No.

Target Background

Function
Recombinant Oenothera parviflora Apocytochrome f (petA) is a component of the cytochrome b6-f complex. This complex mediates electron transfer between photosystem II (PSII) and photosystem I (PSI), facilitates cyclic electron flow around PSI, and participates in state transitions.
Protein Families
Cytochrome f family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Single-pass membrane protein.

Q&A

What is Apocytochrome f and its significance in Oenothera parviflora?

Apocytochrome f, encoded by the petA gene, is a critical component of the cytochrome b6f complex in the photosynthetic electron transport chain located in the thylakoid membrane of chloroplasts. In Oenothera parviflora, this protein plays an essential role in transferring electrons between photosystem II and photosystem I during photosynthesis. The study of this protein is particularly valuable in Oenothera species due to their unique biparental transmission of plastids and the occurrence of genome-plastome incompatibilities, making them ideal models for investigating nuclear-chloroplast interactions .

How does Oenothera's genetic system facilitate research on chloroplast proteins?

Oenothera provides an exceptional model system for studying chloroplast proteins due to several unique genetic features:

  • Biparental transmission of plastids, allowing for tracking of plastid inheritance patterns

  • Stable complex-heterozygosity, which maintains distinct genetic lineages

  • Fertility of interspecific hybrids, enabling the creation of novel genome-plastome combinations

  • Well-documented genome-plastome incompatibilities that can be used to study protein function

These characteristics allow researchers to create specific combinations of nuclear and plastid genomes, facilitating the study of interactions between nuclear-encoded and plastid-encoded components of photosynthetic complexes . The complete sequencing of Oenothera plastomes further enhances its utility as a research model for chloroplast proteins like Apocytochrome f .

What are the standard methods for isolating DNA for recombinant Oenothera protein studies?

DNA isolation from Oenothera species presents challenges due to high polysaccharide and polyphenol content. A modified protocol based on the following methodology is recommended:

  • Lyophilize young tissue samples (approximately 40 mg)

  • Grind tissues at 30 Hz for 60 seconds using a mixer mill

  • Lyse with CF lysis buffer supplemented with RNase (incubate at 65°C for 1 hour under agitation)

  • Add proteinase K and incubate for another hour at 65°C

  • Use Phase-lock gel tubes for DNA recovery to prevent DNA shearing

  • Extract with Phenol:Chloroform:Isoamyl Alcohol (25:24:1)

  • Precipitate DNA with binding buffer and ethanol

  • Store at appropriate conditions based on downstream applications

This methodology helps overcome the challenges of extracting high-quality DNA from Oenothera tissues, which is critical for subsequent cloning and expression of recombinant proteins.

What expression systems are most suitable for producing recombinant Oenothera parviflora Apocytochrome f?

Expression SystemAdvantagesLimitationsRecommended for
E. coliHigh yield, rapid growth, economical, well-established protocolsPotential improper folding, lack of post-translational modificationsStructural studies, antibody production
Yeast (P. pastoris)Eukaryotic post-translational modifications, secretion capabilitiesLonger production time, complex media requirementsFunctional studies requiring proper folding
Insect cellsAdvanced eukaryotic processing, membrane protein expressionExpensive, technically demandingComplex functional studies requiring native-like folding
Plant-based systemsNative folding environment, authentic post-translational modificationsLower yield, longer production timeStudies on protein-protein interactions in photosynthetic complexes

When expressing Apocytochrome f, it's essential to consider whether the mature or precursor form is needed and whether membrane integration is required for the specific research question being addressed .

How should researchers design primers for cloning the petA gene from Oenothera parviflora?

Designing effective primers for cloning the petA gene from Oenothera parviflora requires careful consideration of several factors:

  • Reference the complete plastome sequence of Oenothera species for accurate primer design

  • Identify conserved regions flanking the petA gene by aligning multiple Oenothera plastome sequences

  • Design primers with the following specifications:

    • 18-25 nucleotides in length

    • GC content between 40-60%

    • Melting temperature (Tm) between 55-65°C with minimal difference between forward and reverse primers

    • Avoid secondary structures and primer-dimer formation

  • Include appropriate restriction sites for subsequent cloning, with 3-6 additional nucleotides at the 5' end to ensure efficient enzyme digestion

  • Consider adding tags (His, GST, etc.) if protein purification is planned

  • Validate primers using in silico PCR to ensure specificity

The EST sequences available from Oenothera studies can serve as valuable resources for refining primer design and confirming sequence accuracy .

What purification strategy yields the highest purity of recombinant Apocytochrome f?

A multi-step purification strategy is recommended to achieve high purity of recombinant Apocytochrome f from Oenothera parviflora:

  • Initial clarification: Centrifugation of cell lysate at 11,000 g for 20 minutes to remove cell debris

  • Affinity chromatography: Use of immobilized metal affinity chromatography (IMAC) with Ni-NTA resin for His-tagged Apocytochrome f

  • Ion exchange chromatography: Application of anion exchange chromatography (e.g., Q-Sepharose) to separate proteins based on charge differences

  • Size exclusion chromatography: Final polishing step to separate proteins based on molecular size

  • Quality assessment: SDS-PAGE analysis with Coomassie Brilliant Blue staining or silver staining to evaluate purity

  • Western blot analysis: Confirmation of protein identity using specific antibodies following transfer to nitrocellulose or PVDF membranes

This purification protocol typically yields >95% pure recombinant protein suitable for functional and structural studies.

How can researchers assess the folding and functionality of recombinant Apocytochrome f?

Assessing the proper folding and functionality of recombinant Apocytochrome f requires multiple complementary approaches:

  • Spectroscopic analysis:

    • Circular dichroism (CD) spectroscopy to analyze secondary structure elements

    • Fluorescence spectroscopy to examine tertiary structure

    • UV-visible spectroscopy to assess heme incorporation

  • Functional assays:

    • Electron transfer activity measurements using artificial electron donors/acceptors

    • Reconstitution experiments with other components of the cytochrome b6f complex

    • In vitro binding assays with interaction partners (plastocyanin, ferredoxin)

  • Structural validation:

    • Limited proteolysis to probe folded state resistance to proteases

    • Size exclusion chromatography to assess oligomeric state

    • Thermal shift assays to determine protein stability

Comparison of these parameters between recombinant and native Apocytochrome f provides critical validation of proper folding and function.

What methods are most effective for studying genome-plastome interactions involving the petA gene product?

The study of genome-plastome interactions involving Apocytochrome f requires specialized approaches that leverage Oenothera's unique genetic system:

  • Creation of interspecific hybrids with different genome-plastome combinations:

    • Cross compatible Oenothera species with known genome types (A, B, C) and plastome types (I-V)

    • Select hybrid lines showing various degrees of compatibility/incompatibility

    • Compare Apocytochrome f expression, processing, and function across these combinations

  • Complementation studies:

    • Transform incompatible combinations with nuclear or plastid genes to restore compatibility

    • Assess the role of specific amino acid changes in compatibility restoration

    • Monitor changes in photosynthetic parameters following complementation

  • Protein-protein interaction analysis:

    • Co-immunoprecipitation of Apocytochrome f with nuclear-encoded interaction partners

    • Yeast two-hybrid or split-GFP assays to identify novel interactions

    • Differential interaction mapping between compatible and incompatible combinations

These approaches provide insights into how nuclear and plastid genomes co-evolve and maintain functional interactions between their gene products .

How do researchers address contradictory findings regarding post-translational modifications of Apocytochrome f in Oenothera species?

When faced with contradictory findings regarding post-translational modifications (PTMs) of Apocytochrome f in Oenothera species, researchers should implement a systematic approach:

  • Technical validation:

    • Reproduce experiments using multiple detection methods (mass spectrometry, western blotting with modification-specific antibodies)

    • Compare results across different isolation methods to rule out preparation artifacts

    • Standardize growth conditions to minimize environmental influences on PTMs

  • Biological variability assessment:

    • Examine PTM patterns across different Oenothera species and ecotypes

    • Investigate PTM changes under various environmental conditions (light intensity, temperature, stress)

    • Compare developmental stages to identify stage-specific modifications

  • Functional significance evaluation:

    • Create site-directed mutants that mimic or prevent specific modifications

    • Perform functional assays to determine the impact of PTMs on protein activity

    • Assess protein-protein interactions with and without specific modifications

  • Meta-analysis and integration:

    • Compile and systematically compare all published data on Apocytochrome f PTMs

    • Identify methodological differences that might explain contradictory results

    • Propose a unified model that accounts for observed variability

This comprehensive approach helps resolve contradictions and advances understanding of the functional significance of PTMs in Apocytochrome f.

What are the latest approaches for studying the evolution of petA sequences across Oenothera species and related genera?

Modern evolutionary analysis of petA sequences across Oenothera species and related genera employs several advanced approaches:

  • Comparative genomics:

    • Whole plastome sequencing and assembly using hybrid sequencing technologies (combining Illumina short reads and Oxford Nanopore long reads)

    • Identification of conserved and divergent regions in petA through multiple sequence alignment

    • Detection of selection signatures using dN/dS ratio analysis to identify genes under positive selection pressure

  • Haplotype analysis:

    • Identification of haplotype diversity within and between species

    • Examination of heteroplasmy and its potential evolutionary significance

    • Assessment of recombination events between haplotypes

  • Structure-function relationship analysis:

    • 3D modeling of Apocytochrome f based on sequence variations

    • Identification of structural constraints that maintain function despite sequence divergence

    • Correlation of sequence changes with altered protein-protein interactions

  • Phylogenomic integration:

    • Integration of petA evolution with whole-plastome phylogenetic studies

    • Comparison with nuclear gene evolution to detect co-evolutionary patterns

    • Examination of horizontal gene transfer events involving petA

These approaches reveal how petA has evolved within the Onagraceae family and provide insights into the co-evolution of nuclear and chloroplast genomes .

How can researchers use CRISPR-Cas9 technology to study Apocytochrome f function in Oenothera systems?

Implementing CRISPR-Cas9 technology for studying Apocytochrome f function in Oenothera requires specialized approaches due to the unique genetic characteristics of this system:

  • Chloroplast transformation strategy:

    • Design plastid-specific CRISPR-Cas9 constructs targeting petA

    • Utilize biolistic transformation for chloroplast targeting

    • Select transformants using spectinomycin resistance markers

    • Verify homoplasmy through multiple rounds of selection

  • Nuclear-encoded component modifications:

    • Target nuclear genes encoding proteins that interact with Apocytochrome f

    • Create precise mutations to study specific interaction domains

    • Generate knock-down rather than knock-out lines for essential components

    • Use tissue-specific or inducible promoters for temporal control of editing

  • Genome-plastome compatibility investigation:

    • Engineer specific petA variants to test compatibility hypotheses

    • Transfer edited chloroplasts between species to create novel combinations

    • Monitor phenotypic effects on development, photosynthesis, and fitness

    • Identify compensatory mutations that restore function in incompatible combinations

  • Validation and phenotyping workflow:

    • Confirm edits through sequencing of both plastid and nuclear genomes

    • Assess protein expression and complex assembly via immunoblotting

    • Measure photosynthetic parameters using chlorophyll fluorescence

    • Evaluate growth and development under various light conditions

This CRISPR-based approach provides unprecedented precision in manipulating the Oenothera system to study Apocytochrome f function in vivo .

How should researchers address the challenge of heteroplasmy when studying recombinant Apocytochrome f from Oenothera parviflora?

Heteroplasmy (the presence of multiple plastid genotypes within a single individual) presents significant challenges when studying recombinant Apocytochrome f from Oenothera parviflora. A systematic approach to address this challenge includes:

  • Detection and characterization of heteroplasmy:

    • Utilize hybrid sequencing approaches combining short (Illumina) and long (Oxford Nanopore) reads

    • Implement de novo assembly to accurately reconstruct full heteroplasmy patterns

    • Quantify the relative abundance of different haplotypes using digital PCR or deep sequencing

  • Haplotype separation strategies:

    • Cloning individual haplotypes before recombinant expression

    • Single-molecule sequencing to characterize individual molecules

    • Cell sorting techniques to isolate cells with predominant haplotypes

  • Experimental design considerations:

    • Compare results from different tissue types that may have different levels of heteroplasmy

    • Use vegetative propagation from single shoots to maintain genetic uniformity in experimental material

    • Implement appropriate controls to account for haplotype-specific variations

  • Data analysis approaches:

    • Develop computational pipelines that account for heteroplasmic variants

    • Apply statistical methods that consider heteroplasmy in experimental interpretation

    • Compare protein properties between different haplotypes to assess functional significance

By implementing these strategies, researchers can transform heteroplasmy from an experimental challenge into a valuable source of information about sequence-function relationships in Apocytochrome f .

What are the optimal conditions for expressing and solubilizing membrane-associated Apocytochrome f?

Expressing and solubilizing membrane-associated Apocytochrome f requires optimized conditions at each step of the process:

Process StageKey ParametersOptimal ConditionsRationale
ExpressionTemperature18-20°CReduces inclusion body formation
Inducer concentration0.1-0.5 mM IPTGBalances expression level and proper folding
Growth phaseMid-log phase (OD600 0.6-0.8)Cells are metabolically active
Duration16-20 hoursAllows time for proper folding
Cell lysisBuffer composition50 mM Tris-HCl pH 8.0, 300 mM NaCl, 10% glycerolStabilizes protein during extraction
Protease inhibitorsComplete EDTA-free cocktailPrevents degradation
Lysis methodSonication (10s on/10s off, 3 min total)Efficient while minimizing heat denaturation
Membrane extractionCentrifugation100,000 g for 1 hourSeparates membrane fraction
SolubilizationDetergent typen-Dodecyl β-D-maltoside (DDM)Mild detergent preserving structure
Detergent concentration1% for extraction, 0.05% for purificationSufficient for solubilization without excess
Incubation4°C for 2 hours with gentle rotationThorough solubilization with minimal denaturation
PurificationFlow rate0.5 ml/minAllows sufficient binding time
Imidazole gradient20-250 mMReduces non-specific binding

These optimized conditions maximize the yield of properly folded, functional Apocytochrome f while minimizing aggregation and denaturation . The protocol can be further refined based on specific experimental requirements and protein variants.

How might artificial intelligence approaches advance the study of structure-function relationships in Oenothera Apocytochrome f?

Artificial intelligence (AI) approaches offer transformative potential for studying structure-function relationships in Oenothera Apocytochrome f through several innovative applications:

  • Structure prediction and analysis:

    • Implementation of AlphaFold2 or RoseTTAFold to predict high-accuracy structures of Apocytochrome f variants

    • Comparative structural analysis across Oenothera species to identify conserved structural elements despite sequence divergence

    • Prediction of protein-protein interaction surfaces with membrane partners and soluble electron carriers

  • Machine learning for functional prediction:

    • Development of neural networks trained on experimental data to predict electron transfer rates based on sequence variations

    • Pattern recognition algorithms to identify sequence motifs associated with genome-plastome compatibility

    • Classification models to predict the functional impact of naturally occurring or engineered mutations

  • Big data integration:

    • Multi-omics data integration (genomics, transcriptomics, proteomics, metabolomics) to map the impact of Apocytochrome f variations on cellular networks

    • Text mining of scientific literature to extract and synthesize fragmented knowledge about Oenothera Apocytochrome f

    • Automated hypothesis generation based on integrated datasets to guide experimental design

  • Molecular dynamics simulations:

    • AI-accelerated molecular dynamics to simulate protein behavior in membrane environments

    • Free energy calculations to quantify binding energetics with interaction partners

    • Identification of allosteric communication pathways within the protein structure

These AI approaches can significantly accelerate research by generating testable hypotheses, reducing experimental iterations, and revealing patterns not readily apparent through traditional methods .

What emerging technologies hold promise for understanding the role of Apocytochrome f in genome-plastome incompatibility?

Several emerging technologies show exceptional promise for advancing our understanding of Apocytochrome f's role in genome-plastome incompatibility in Oenothera:

  • Single-cell omics technologies:

    • Single-cell proteomics to detect cell-specific variations in Apocytochrome f processing and interactions

    • Spatial transcriptomics to map gene expression patterns in developing tissues with incompatibility symptoms

    • Single-cell metabolomics to characterize metabolic consequences of incompatibility at cellular resolution

  • Advanced imaging techniques:

    • Cryo-electron tomography to visualize native cytochrome b6f complex architecture in compatible versus incompatible combinations

    • Super-resolution microscopy to track protein distribution and dynamics in living cells

    • Label-free imaging methods to monitor photosynthetic performance in situ

  • Synthetic biology approaches:

    • Minimal synthetic chloroplasts with defined gene content to test specific compatibility hypotheses

    • Orthogonal translation systems to incorporate non-canonical amino acids for tracking and functional studies

    • Designer protein scaffolds to rewire electron transport pathways and test functional redundancy

  • Systems biology integration:

    • Genome-scale metabolic models incorporating specific Apocytochrome f variants

    • Flux balance analysis to predict metabolic consequences of altered electron transport

    • Multi-scale modeling from molecular interactions to whole-plant phenotypes

These emerging technologies, especially when used in combination, offer unprecedented opportunities to mechanistically understand how Apocytochrome f functions at the interface between nuclear and plastid genomes in determining compatibility relationships .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.