Recombinant Oenothera parviflora Cytochrome c biogenesis protein ccsA (ccsA)

Shipped with Ice Packs
In Stock

Description

Definition and Biological Context

Recombinant Oenothera parviflora Cytochrome c biogenesis protein ccsA (ccsA) is a 319-amino acid protein (UniProt ID: B0Z5H6) expressed in heterologous systems such as Escherichia coli or yeast, typically fused with an N-terminal His tag for purification . This protein belongs to System II cytochrome c biogenesis pathways, which are responsible for the covalent attachment of heme to apocytochrome c in bacteria, plants, and algae .

Functional Role in Cytochrome c Biogenesis

ccsA functions as part of a membrane-bound complex (often with ccsB) to facilitate heme transport and attachment to apocytochrome c via thioether bonds :

  • Heme Trafficking: Two conserved histidines in TMDs (e.g., His-761 and His-897 in Helicobacter hepaticus CcsBA) enable heme translocation across membranes .

  • Heme Protection: External histidines in the WWD domain bind reduced heme (Fe²⁺), shielding it from oxidation in periplasmic/compartments .

  • Synthetase Activity: Acts as a cytochrome c synthetase, directly attaching heme to the CXXCH motif of apocytochrome c .

4.1. Heme Binding and Redox Regulation

  • Mutations in external histidines (e.g., H761A or H897A) disrupt heme binding and result in oxidized heme (Fe³⁺), abolishing synthetase activity .

  • The WWD domain residues (e.g., W828, W833, E843) are essential for heme interaction, as shown by cysteine/heme crosslinking assays .

4.3. Recombinant Production and Applications

  • Expression Systems: Successfully produced in E. coli with ≥85% purity, enabling biochemical and structural studies .

  • Functional Assays: Used to reconstitute cytochrome c synthesis in vitro and study heme trafficking mechanisms .

Applications in Research

  1. Mechanistic Studies: Elucidating heme transport and cytochrome c assembly in System II pathways .

  2. Oxidative Stress Models: Investigating heme redox regulation in periplasmic compartments .

  3. Protein Engineering: Optimizing recombinant cytochrome c production for biotechnological applications .

Limitations and Future Directions

  • Knowledge Gaps: Structural details of plant-specific ccsA variants (e.g., Oenothera parviflora) remain underexplored.

  • Technical Challenges: Low stability of heme-bound intermediates complicates crystallization .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them during order placement, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery times, please consult your local distributors.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please notify us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is established during production. If you have a specific tag type in mind, please inform us, and we will prioritize its development.
Synonyms
ccsA; Cytochrome c biogenesis protein CcsA
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-319
Protein Length
full length protein
Species
Oenothera parviflora (Small-flowered evening primrose) (Oenothera cruciata)
Target Names
ccsA
Target Protein Sequence
MIFYTLEHILTHISFSLVSIGITIFLITLSVDEIIGLYDSSEKGVIGTFLCITGLLVTRW AYSGHFPLSNLYESLLFLSWSFAIIHMFPYLKKQKSYVRTITSSSTIFTQGLVTSGLLSE MQQSEILVPALQSQWLMMHVSMMVLGYAALLCGSLLSVALLVITFRKARKIFSKKKAFLK DSFSFVEIQYRNEPSNVLLSTSFISSKNYYRAQLIQQLDRWSSRIISLGFIFLTIGILSG AVWANEAWGSYWNWDPKETWAFITWTMFAIYLHTRTNPNFQSVNSAIVAFLGFIIIWICY FGVNLLGIGLHSYGSFNLH
Uniprot No.

Target Background

Function
Essential during biogenesis of c-type cytochromes (cytochrome c6 and cytochrome f) at the heme attachment step.
Protein Families
CcmF/CycK/Ccl1/NrfE/CcsA family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the ccsA protein and what is its role in cytochrome c biogenesis?

CcsA is a polytopic membrane protein with functional domains exposed to the lumen and four strictly conserved histidine residues on both the lumen and stromal sides of the thylakoid membrane. It contains the characteristic WWD signature motif and functions as an essential component of the cytochrome c maturation (CCS) pathway in plastids .

CcsA works in concert with CCS1 to relay heme from its synthesis site in the stroma to the lumen where it can be attached to apocytochromes. Together, these proteins catalyze the stereospecific attachment of ferroheme to apocytochromes via thioether linkages, a process crucial for the formation of functional cytochromes c . Experimental evidence from bacterial systems has confirmed that CcsA-Ccs1 fusion proteins can successfully assemble cytochrome c in Escherichia coli strains lacking endogenous cytochrome c assembly machinery .

How does the structure-function relationship of ccsA contribute to its activity?

The structure of ccsA reveals several key functional domains essential for its activity:

  • Transmembrane domains: CcsA is a polytopic membrane protein that spans the thylakoid membrane multiple times .

  • Histidine residues: Four strictly conserved histidine residues are present on both the lumen and stromal sides of the membrane. The two periplasm-facing (lumen-facing in plastids) histidines are crucial for binding heme and maintaining it in a reduced state .

  • WWD signature motif: This conserved domain in CcsA is believed to be involved in heme handling and delivery to apocytochromes .

  • Heme binding site: Spectroscopic analyses and mutagenesis studies have identified a heme binding site on the lumenal/periplasmic side of CcsA that is essential for cytochrome c synthase activity .

Mutations of the two transmembrane cytoplasm-facing histidines in bacterial systems demonstrated that these residues provide an entry site for heme through the lipid bilayer, highlighting their importance in the heme relay mechanism .

What are the recommended methods for cloning and expressing recombinant Oenothera parviflora ccsA?

Cloning Strategies:

  • Gene synthesis: Given the sequence information available from Oenothera plastid genomes, gene synthesis offers a reliable approach for obtaining the ccsA coding sequence with appropriate codon optimization for the chosen expression system .

  • PCR amplification: Primers can be designed based on conserved regions of the ccsA gene. Genomic DNA extraction from Oenothera parviflora tissue should follow standard protocols for plant materials with high polyphenol content .

Expression Systems:

  • E. coli expression: Despite being a membrane protein, bacterial expression systems have successfully been used for producing recombinant CcsA-Ccs1 fusion proteins from bacterial sources . For Oenothera parviflora ccsA, consider using E. coli strains optimized for membrane protein expression (e.g., C41/C43).

  • Homologous reconstitution: Given that experimental studies have shown functional complementation in bacterial systems lacking endogenous cytochrome c assembly machinery, a similar approach could be used to test Oenothera parviflora ccsA functionality .

What techniques are effective for purifying functional recombinant ccsA protein?

Purification Methodology:

  • Membrane fraction isolation: Prepare thylakoid membranes following established protocols that include differential centrifugation and washing steps to remove soluble proteins .

  • Detergent solubilization: Select appropriate detergents (e.g., n-dodecyl-β-D-maltoside or digitonin) that maintain protein structure and function.

  • Affinity chromatography: Using affinity tags (His-tag or FLAG-tag) positioned to avoid interference with the WWD domain or histidine residues critical for function.

  • Size exclusion chromatography: As a final purification step to obtain homogeneous protein preparations and to assess complex formation.

Functional Verification:

Spectroscopic analysis should be employed to confirm heme binding capacity, similar to studies performed on bacterial CcsA-Ccs1 fusion proteins that demonstrated the presence of bound heme through spectroscopic methods .

How can I assess the functionality of recombinant Oenothera parviflora ccsA in vitro?

In vitro Reconstitution Assays:

  • Heme binding assessment: Spectroscopic analyses similar to those performed with the Helicobacter hepaticus Ccs1-CcsA fusion protein can determine whether recombinant Oenothera parviflora ccsA binds heme . UV-visible spectroscopy can detect characteristic absorbance patterns of bound heme.

  • Heme transfer assays: Using fluorescently labeled heme analogs to track heme movement from CcsA to apocytochromes c.

  • Cytochrome c assembly assay: Reconstitution of the complete cytochrome c maturation system in liposomes or nanodiscs, providing apocytochrome c, heme, and other necessary components to measure holocytochrome c formation.

Functional Complementation:

Expressing recombinant Oenothera parviflora ccsA in CCS-deficient bacterial or algal systems (e.g., Chlamydomonas ccsA mutants) to assess its ability to restore cytochrome c maturation .

How does ccsA interact with other components of the cytochrome c maturation pathway?

The CCS pathway in plastids is more complex than in bacteria and involves several components:

  • CcsA-CCS1 complex: In Chlamydomonas, a 200 kDa CCS1-containing complex was identified, which failed to accumulate in ccsA mutants, suggesting that CcsA and CCS1 form a functional complex . This complex is believed to relay heme from the stroma to the lumen.

  • Additional components: Unlike bacterial systems that require only CcsA, Ccs1, a thiol-disulfide reductase, and a thioredoxin-like protein, plastid cytochrome c maturation requires additional factors including CCS4 and the products of the CCS2, CCS3, and CCS6 genes .

Interaction Analysis Methods:

  • Co-immunoprecipitation: To identify interaction partners of ccsA using antibodies against the recombinant protein.

  • Blue native PAGE: To analyze the intact native complexes containing ccsA.

  • Crosslinking studies: To capture transient interactions between ccsA and other components of the maturation pathway.

How can site-directed mutagenesis of ccsA advance understanding of its mechanism?

Strategic Mutation Targets:

  • Conserved histidine residues: Mutating the four strictly conserved histidine residues (two on the lumenal side and two on the stromal side) can provide insights into their specific roles in heme relay and binding .

  • WWD motif: Altering residues in this signature domain can help determine its precise function in heme handling and cytochrome interaction .

  • Transmembrane domains: Mutations in these regions can illuminate how heme is transported across the membrane.

Expected Outcomes and Analysis:

Previous studies with bacterial CcsA-Ccs1 fusion proteins showed that mutating the periplasm-facing histidines affected heme binding and its redox state, while mutating cytoplasm-facing histidines eliminated heme detection in the recombinant protein . Similar approaches with Oenothera parviflora ccsA could reveal species-specific characteristics of the protein and potentially elucidate evolutionary adaptations in the cytochrome c maturation pathway.

What approaches can be used to study the evolutionary significance of ccsA variation in Oenothera species?

Oenothera provides a unique model system for studying plastid-nuclear genome compatibility and evolution .

Methodological Approaches:

  • Comparative sequence analysis: Aligning ccsA sequences from all five basic Oenothera plastomes to identify variation patterns that might contribute to species-specific adaptations .

  • Functional complementation experiments: Testing ccsA variants from different Oenothera plastomes in heterologous systems to assess functional differences.

  • Analysis of naturally occurring plastome-genome incompatible combinations: Investigating whether ccsA variations correlate with incompatibility phenotypes observed in certain Oenothera hybrids .

Evolutionary Context:

Molecular data from Oenothera strongly supports the view that regulation of photosynthesis is a driving force of plastid-genome incompatibility (PGI) . Analyzing whether ccsA plays a role in this process could provide insights into the broader evolutionary significance of cytochrome c maturation pathways.

What are the common challenges in working with recombinant ccsA and how can they be addressed?

Expression Challenges:

  • Low expression levels: As a membrane protein, ccsA may express poorly in heterologous systems.

    • Solution: Optimize codon usage for the expression host, use specialized strains designed for membrane protein expression, and consider fusion partners that enhance expression.

  • Protein misfolding: Improper folding in the membrane can lead to aggregation or degradation.

    • Solution: Adjust induction conditions (temperature, inducer concentration), use mild detergents for extraction, and consider co-expression with chaperones.

Purification Challenges:

  • Detergent selection: Finding a detergent that effectively solubilizes ccsA while maintaining its structure and function.

    • Solution: Screen multiple detergents systematically; consider using lipid nanodiscs or amphipols for stabilization.

  • Protein instability: Loss of activity during purification procedures.

    • Solution: Include stabilizing agents (glycerol, specific lipids), perform purification at 4°C, and minimize exposure to air oxidation.

How can I develop reliable assays to measure ccsA activity in experimental systems?

Activity Assay Development:

  • Heme binding assay: Spectroscopic measurement of heme association with purified ccsA.

    • Protocol elements: Incubate purified protein with reduced heme under anaerobic conditions, remove unbound heme, and measure absorption spectra.

  • Heme transport assay: Measuring heme transfer across membrane vesicles containing reconstituted ccsA.

    • Approach: Prepare proteoliposomes with incorporated ccsA, add heme to the external medium, and measure heme accumulation in the internal compartment.

  • Complete cytochrome c assembly assay: Reconstituting the full pathway in vitro.

    • Components needed: Purified ccsA, CCS1, apocytochrome c, heme, and other necessary factors in an appropriate membrane environment.

    • Readout: Formation of mature holocytochrome c detected by spectroscopy or activity assays.

Data Analysis and Interpretation:

When evaluating activity, it's essential to distinguish between specific activity and background reactions. Include appropriate controls such as heat-inactivated protein, mutated versions of ccsA lacking key functional residues, and reactions lacking essential components.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.