Recombinant Oenothera parviflora NAD(P)H-quinone oxidoreductase subunit 3, chloroplastic, is a protein that is part of the NAD(P)H dehydrogenase complex found in the chloroplasts of Oenothera parviflora (small-flowered evening primrose) . This protein, encoded by the ndhC gene, functions as a subunit of the NAD(P)H-quinone oxidoreductase complex, which is involved in electron transport and protection against oxidative stress in plants . The recombinant form of this protein is produced using genetic engineering techniques, allowing for research and industrial applications .
Oenothera parviflora NAD(P)H-quinone oxidoreductase subunit 3, chloroplastic, is a component of the thylakoid membrane-bound NAD(P)H dehydrogenase complex (NDH) . The NDH complex mediates electron transfer from NAD(P)H to plastoquinone, playing a crucial role in various photosynthetic processes, including cyclic electron flow, chlororespiration, and protection against oxidative stress .
Key Details:
Recommended Name: NAD(P)H-quinone oxidoreductase subunit 3, chloroplastic
Alternative Names: NAD(P)H dehydrogenase subunit 3, NADH-plastoquinone oxidoreductase subunit 3
Sequence Length: The protein is a full-length protein consisting of 120 amino acids .
The recombinant protein is produced through genetic engineering, where the ndhC gene from Oenothera parviflora is expressed in a host organism such as E. coli . The expressed protein is then isolated and purified for use in various applications . The recombinant protein often includes a tag, such as a His-tag, to facilitate purification .
Production Details:
Expression Region: The recombinant protein corresponds to amino acids 1-120 of the native protein .
Tag Information: The specific tag type is determined during the production process . A His-tag is commonly used .
AA Sequence: MFLLYEYDIFWAFLIISSVIPILAFRISGLLAPTSKGPEKLSSYESGIEPMGDAWLQFRI RYYMFALVFVVFDVETIFLYPWALSFDILGVSVFIEALIFVLILVLGLVYAWRKGALEWS
The NAD(P)H-quinone oxidoreductase subunit 3, chloroplastic, is essential for the function of the NDH complex in Oenothera parviflora . The NDH complex is involved in:
Cyclic Electron Flow: Facilitating electron transfer around photosystem I, which helps in ATP production without NADPH generation .
Chlororespiration: Participating in the reduction of oxygen in the chloroplast, especially under stress conditions .
Oxidative Stress Protection: Reducing the accumulation of reactive oxygen species (ROS) by maintaining a balance in the electron transport chain .
Recombinant Oenothera parviflora NAD(P)H-quinone oxidoreductase subunit 3, chloroplastic, is used in various research and industrial applications :
ELISA Assays: The recombinant protein can be used as an antigen in enzyme-linked immunosorbent assays (ELISA) to detect and quantify antibodies against Oenothera parviflora NDH complex subunits .
Structural Studies: It can be utilized in structural biology to determine the three-dimensional structure of the protein and understand its interactions within the NDH complex .
Functional Studies: The recombinant protein allows for in vitro functional assays to study its role in electron transport, quinone reduction, and other related processes .
Antibody Production: Recombinant proteins can be used to generate specific antibodies for research purposes .
Several related products are available for research on Oenothera parviflora NDH complex and photosynthesis :
Antibodies: Specific antibodies against NAD(P)H-quinone oxidoreductase subunit 3 and other NDH subunits .
ELISA Kits: ELISA kits for quantifying NAD(P)H-quinone oxidoreductase subunit 3 in plant samples .
Recombinant Proteins: Other recombinant subunits of the Oenothera parviflora NDH complex .
Enzyme Inhibitors: Inhibitors of NAD(P)H-quinone oxidoreductases to study their function .
How is recombinant NAD(P)H-quinone oxidoreductase subunit 3 typically stored and handled in laboratory settings?
For optimal stability, recombinant NAD(P)H-quinone oxidoreductase subunit 3 should be stored at -20°C, and for extended storage, at -80°C. The protein is typically supplied in a Tris-based buffer containing 50% glycerol optimized for stability .
When working with this protein:
What is the relationship between NAD(P)H-quinone oxidoreductase subunit 3 and other subunits in the NDH complex?
The NAD(P)H-quinone oxidoreductase complex in chloroplasts consists of multiple subunits that work together for electron transport. From the search results, we can identify several related subunits:
These subunits assemble into a functional complex that spans the thylakoid membrane, facilitating electron transport from NAD(P)H to plastoquinone. NdhC (subunit 3) is thought to interact directly with NdhE and NdhG in the membrane domain of the complex .
What experimental approaches are most effective for studying protein-protein interactions between NAD(P)H-quinone oxidoreductase subunit 3 and other complex components?
Several methodological approaches are recommended for studying protein-protein interactions within the NDH complex:
Co-immunoprecipitation (Co-IP): Using antibodies against specific subunits like NdhH (AS16 4065) or NdhB (AS16 4064) to pull down associated proteins, followed by western blotting or mass spectrometry.
Blue Native-PAGE: This technique preserves protein-protein interactions and can separate intact membrane protein complexes, allowing visualization of the entire NDH complex and subcomplexes.
Yeast Two-Hybrid or Split-Ubiquitin Assays: Particularly useful for membrane proteins, these can identify direct interactions between NdhC and other subunits.
FRET/BRET Analysis: By creating fluorescent fusion proteins with NdhC and potential interacting partners, resonance energy transfer can detect proximity in vivo.
Crosslinking Mass Spectrometry: Chemical crosslinking followed by mass spectrometry can identify proteins in close proximity within the complex.
For confirmation of interactions, researchers should employ multiple complementary techniques, as membrane protein interactions can be challenging to study with a single approach.
How can the enzymatic activity of recombinant NAD(P)H-quinone oxidoreductase be accurately measured in vitro?
Measuring the enzymatic activity of NAD(P)H-quinone oxidoreductase requires specific methodological considerations:
Spectrophotometric Assays: Monitor the oxidation of NAD(P)H at 340 nm in the presence of quinone substrates. The decrease in absorbance correlates with enzyme activity .
Recommended Assay Conditions:
Buffer: 50 mM potassium phosphate (pH 7.4)
Temperature: 25-30°C
Substrates: NAD(P)H (100-200 μM) and quinone (50-100 μM)
Controls: Include reactions without enzyme or without substrate
Potential Quinone Substrates:
Data Analysis Parameters:
Calculate initial rates from the linear portion of progress curves
Determine kinetic parameters (Km, Vmax) using Michaelis-Menten equations
Account for potential substrate inhibition at high quinone concentrations
The choice of quinone substrate is critical as different quinone oxidoreductases show varying substrate preferences. For example, while some enzymes efficiently reduce simple quinones like 1,4-benzoquinone, others like PcQOR from Phytophthora capsici show strong activity toward larger substrates like 9,10-phenanthrenequinone .
What structural features distinguish NAD(P)H-quinone oxidoreductase subunit 3 from other NDH complex components, and how do these relate to function?
NAD(P)H-quinone oxidoreductase subunit 3 (NdhC) possesses several distinguishing structural features:
Transmembrane Domains: Analysis of the amino acid sequence indicates multiple hydrophobic regions that form transmembrane helices, anchoring the protein in the thylakoid membrane .
Secondary Structure Composition:
Predominantly α-helical (approximately 60-70%)
Contains several conserved charged residues (particularly lysines and arginines) at the stromal-facing regions
Features a characteristic "MFLLYEY" N-terminal motif
Functional Domains:
| Domain | Approximate Position | Proposed Function |
|---|---|---|
| N-terminal region | 1-20 | Membrane insertion and topology |
| Central hydrophobic core | 21-90 | Membrane spanning and quinone interaction |
| C-terminal region | 91-120 | Interaction with other NDH subunits |
Comparative Features: Unlike larger subunits such as NdhB and NdhH, which contain extensive stromal domains involved in NAD(P)H binding, NdhC is primarily involved in membrane integration and electron transfer through the complex rather than direct cofactor binding .
These structural features position NdhC as a critical component in the membrane domain of the NDH complex, likely functioning in electron transfer rather than as a catalytic subunit.
What genomic approaches can be employed to study the evolution and conservation of the ndhC gene across different plant species?
Several genomic approaches are valuable for evolutionary studies of the ndhC gene:
Comparative Genomics:
Phylogenetic Analysis:
Maximum likelihood and Bayesian inference methods to construct evolutionary trees
Analysis of selection pressure (dN/dS ratios) to identify regions under positive, neutral, or purifying selection
Molecular clock analyses to date divergence events
Population Genetics:
Structural RNA Analysis:
Oenothera species provide an excellent model system for such studies due to their unique genetic properties and the extensive characterization of their plastid genomes, as documented in the literature .
How do mutations in NAD(P)H-quinone oxidoreductase subunit 3 affect plant photosynthetic efficiency and stress responses?
Mutations in NAD(P)H-quinone oxidoreductase subunit 3 (ndhC) can significantly impact plant physiology in several ways:
Effects on Cyclic Electron Flow:
Cyclic electron flow around Photosystem I is reduced
Decreased ATP production under high light or drought stress conditions
Altered ATP/NADPH ratio affecting carbon fixation efficiency
Impact on Photosynthetic Parameters:
Stress Response Alterations:
Molecular Approach to Study Mutations:
The proper functioning of NdhC is particularly important under stress conditions, and mutations can reveal the role of specific amino acid residues in maintaining photosynthetic efficiency.
What proteomics approaches are most suitable for studying the assembly and dynamics of the NDH complex containing NAD(P)H-quinone oxidoreductase subunit 3?
Advanced proteomics approaches for studying NDH complex assembly and dynamics include:
Quantitative Proteomics:
SILAC (Stable Isotope Labeling with Amino acids in Cell culture) to track newly synthesized proteins
iTRAQ or TMT labeling for multiplexed quantitative analysis across different conditions
Label-free quantification to compare abundance of NDH subunits under various stress conditions
Structural Proteomics:
Hydrogen-deuterium exchange mass spectrometry (HDX-MS) to map protein-protein interfaces
Chemical crosslinking-MS to identify spatial proximity of subunits
Native mass spectrometry to determine stoichiometry and stability of subcomplexes
Temporal Assembly Analysis:
Pulse-chase experiments combined with immunoprecipitation to track assembly intermediates
Ribosome profiling to investigate translation dynamics of NDH complex components
Time-resolved proteomics following induction of complex assembly
Sample Preparation Considerations:
Isolation of intact thylakoid membranes using differential centrifugation
Solubilization with mild detergents (digitonin, n-dodecyl-β-D-maltoside)
Blue-native PAGE separation prior to MS analysis
For Western blot analysis of specific subunits:
These approaches, when combined, provide a comprehensive view of the assembly, stoichiometry, and dynamics of the NDH complex containing the NdhC subunit.
How does the redox state of NAD(P)H affect the function of quinone oxidoreductases, and what methods can be used to manipulate this in experimental settings?
The NAD(P)H redox state significantly influences quinone oxidoreductase function through several mechanisms:
Mechanistic Impact of NAD(P)H/NAD(P)⁺ Ratio:
Experimental Methods to Manipulate Redox State:
Treatment with β-lapachone, a redox-cycling quinone that efficiently alters NAD(P)⁺/NAD(P)H ratios
Light/dark transitions to modulate photosynthetic electron transport in plant systems
Addition of specific inhibitors like dicoumarol for mammalian NQO1
Chemical modulation with H₂O₂ or DTT to alter cellular redox environments
Measurement of Redox Effects:
Real-time monitoring of NAD(P)H fluorescence (excitation: 340 nm, emission: 460 nm)
Enzymatic cycling assays to determine NAD(P)⁺/NAD(P)H ratios
Electrochemical methods using NAD(P)H-sensitive electrodes
Genetically encoded fluorescent redox sensors
Biological Consequences of Altered Redox State:
Research by Kim et al. demonstrated that β-lapachone treatment, which modulates NAD(P)⁺/NAD(P)H balance through NQO1-mediated metabolism, activated the AMP-activated protein kinase (AMPK) pathway and provided protection against various stress conditions .
What are the most effective expression systems for producing functional recombinant NAD(P)H-quinone oxidoreductase subunit 3 for structural studies?
Selecting the optimal expression system for recombinant NdhC production requires consideration of several factors:
Expression System Comparison:
| System | Advantages | Disadvantages | Best For |
|---|---|---|---|
| E. coli | High yield, simple culture | Membrane protein folding issues | Truncated constructs, fusion proteins |
| Yeast (S. cerevisiae/P. pastoris) | Post-translational modifications, membrane protein machinery | Lower yield than E. coli | Full-length membrane proteins |
| Insect cells (Sf9, Hi5) | Complex eukaryotic folding machinery | Higher cost, longer production time | Structural studies requiring native folding |
| Plant-based (tobacco, Chlamydomonas) | Native environment for chloroplast proteins | Lower yields, specialized expertise | Functional studies requiring authentic lipid environment |
Protein Engineering Strategies:
Addition of purification tags (His₆, GST, MBP) at termini least likely to disrupt function
Truncation of terminal regions to improve expression while maintaining core structure
Fusion with GFP to monitor expression and folding quality
Addition of solubility-enhancing partners for membrane proteins
Optimized Production Protocol:
For E. coli: Use specialized strains (C41, C43) designed for membrane protein expression
Induce at lower temperatures (16-20°C) to improve folding
Include stabilizing additives (glycerol, specific detergents) in lysis buffers
Use mild solubilization conditions to maintain native structure
Purification Considerations:
Two-step purification (affinity followed by size exclusion chromatography)
Detergent screening to identify optimal solubilization conditions
Lipid nanodisc or amphipol reconstitution for structural studies
The strategy should be tailored to the intended experimental application, with structural studies requiring the highest purity and conformational homogeneity.
How can researchers investigate the role of NAD(P)H-quinone oxidoreductase in plant responses to environmental stress conditions?
Investigating the role of NAD(P)H-quinone oxidoreductase in stress responses requires a multi-faceted approach:
Stress Exposure Protocols:
High light stress (800-1500 μmol photons m⁻² s⁻¹ for 2-6 hours)
Drought stress (withholding water until specific soil moisture content)
Temperature stress (4°C for cold or 40°C for heat stress)
Combined stresses to mimic natural conditions
Physiological Measurements:
Molecular and Biochemical Analyses:
Genetic Approaches:
Generation of knockout/knockdown lines for NdhC
Complementation with wildtype or mutated versions
Overexpression studies to assess potential stress tolerance enhancement
CRISPR/Cas9 base editing for targeted amino acid substitutions
Multi-Omics Integration:
Transcriptomics to identify stress-responsive gene networks
Metabolomics to analyze changes in redox-related metabolites
Proteomics to determine protein-protein interaction changes under stress
These methods, when combined, provide a comprehensive understanding of how NAD(P)H-quinone oxidoreductase contributes to plant stress adaptations and which specific aspects of its function are most critical during environmental challenges.
What potential biotechnological applications could arise from research on NAD(P)H-quinone oxidoreductase subunit 3 and related proteins?
Research on NAD(P)H-quinone oxidoreductase subunit 3 and related proteins offers several promising biotechnological applications:
Crop Improvement:
Engineering plants with enhanced NDH complex function for improved drought tolerance
Modifying cyclic electron flow for better photosynthetic efficiency under fluctuating light conditions
Creating stress-resistant crop varieties through targeted modifications of NDH subunits
Biocatalysis and Green Chemistry:
Development of biocatalysts for detoxification of quinone-containing environmental pollutants
Enzyme-based sensors for detecting quinones and related compounds
Bioremediation applications targeting quinone-based industrial waste
Pharmaceutical Applications:
Drug screening platforms targeting quinone oxidoreductases for disease treatment
Identification of compounds that modulate NAD(P)⁺/NAD(P)H balance for therapeutic purposes
Development of enzyme inhibitors or activators as potential therapeutics
Renewable Energy:
Bio-inspired design of artificial photosynthetic systems for energy production
Incorporation of modified enzymes into biofuel cells
Engineering of photosynthetic organisms for enhanced biofuel production
The unique electron transport properties of these enzymes, combined with their roles in stress responses, make them valuable targets for multiple biotechnological applications across different sectors.