Recombinant Oenothera parviflora NAD (P)H-quinone oxidoreductase subunit 3, chloroplastic

Shipped with Ice Packs
In Stock

Description

Overview

Recombinant Oenothera parviflora NAD(P)H-quinone oxidoreductase subunit 3, chloroplastic, is a protein that is part of the NAD(P)H dehydrogenase complex found in the chloroplasts of Oenothera parviflora (small-flowered evening primrose) . This protein, encoded by the ndhC gene, functions as a subunit of the NAD(P)H-quinone oxidoreductase complex, which is involved in electron transport and protection against oxidative stress in plants . The recombinant form of this protein is produced using genetic engineering techniques, allowing for research and industrial applications .

Protein Information

Oenothera parviflora NAD(P)H-quinone oxidoreductase subunit 3, chloroplastic, is a component of the thylakoid membrane-bound NAD(P)H dehydrogenase complex (NDH) . The NDH complex mediates electron transfer from NAD(P)H to plastoquinone, playing a crucial role in various photosynthetic processes, including cyclic electron flow, chlororespiration, and protection against oxidative stress .

Key Details:

  • Recommended Name: NAD(P)H-quinone oxidoreductase subunit 3, chloroplastic

  • Alternative Names: NAD(P)H dehydrogenase subunit 3, NADH-plastoquinone oxidoreductase subunit 3

  • Gene Name: ndhC

  • Species: Oenothera parviflora (Oenothera cruciata)

  • Sequence Length: The protein is a full-length protein consisting of 120 amino acids .

  • Uniprot No.: B0Z5B4

Production and Structure

The recombinant protein is produced through genetic engineering, where the ndhC gene from Oenothera parviflora is expressed in a host organism such as E. coli . The expressed protein is then isolated and purified for use in various applications . The recombinant protein often includes a tag, such as a His-tag, to facilitate purification .

Production Details:

  • Expression Region: The recombinant protein corresponds to amino acids 1-120 of the native protein .

  • Tag Information: The specific tag type is determined during the production process . A His-tag is commonly used .

  • AA Sequence: MFLLYEYDIFWAFLIISSVIPILAFRISGLLAPTSKGPEKLSSYESGIEPMGDAWLQFRI RYYMFALVFVVFDVETIFLYPWALSFDILGVSVFIEALIFVLILVLGLVYAWRKGALEWS

Function and Role

The NAD(P)H-quinone oxidoreductase subunit 3, chloroplastic, is essential for the function of the NDH complex in Oenothera parviflora . The NDH complex is involved in:

  1. Cyclic Electron Flow: Facilitating electron transfer around photosystem I, which helps in ATP production without NADPH generation .

  2. Chlororespiration: Participating in the reduction of oxygen in the chloroplast, especially under stress conditions .

  3. Oxidative Stress Protection: Reducing the accumulation of reactive oxygen species (ROS) by maintaining a balance in the electron transport chain .

Applications

Recombinant Oenothera parviflora NAD(P)H-quinone oxidoreductase subunit 3, chloroplastic, is used in various research and industrial applications :

  1. ELISA Assays: The recombinant protein can be used as an antigen in enzyme-linked immunosorbent assays (ELISA) to detect and quantify antibodies against Oenothera parviflora NDH complex subunits .

  2. Structural Studies: It can be utilized in structural biology to determine the three-dimensional structure of the protein and understand its interactions within the NDH complex .

  3. Functional Studies: The recombinant protein allows for in vitro functional assays to study its role in electron transport, quinone reduction, and other related processes .

  4. Antibody Production: Recombinant proteins can be used to generate specific antibodies for research purposes .

Related Products

Several related products are available for research on Oenothera parviflora NDH complex and photosynthesis :

  1. Antibodies: Specific antibodies against NAD(P)H-quinone oxidoreductase subunit 3 and other NDH subunits .

  2. ELISA Kits: ELISA kits for quantifying NAD(P)H-quinone oxidoreductase subunit 3 in plant samples .

  3. Recombinant Proteins: Other recombinant subunits of the Oenothera parviflora NDH complex .

  4. Enzyme Inhibitors: Inhibitors of NAD(P)H-quinone oxidoreductases to study their function .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
ndhC; NAD(PH-quinone oxidoreductase subunit 3, chloroplastic; NAD(PH dehydrogenase subunit 3; NADH-plastoquinone oxidoreductase subunit 3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-120
Protein Length
full length protein
Species
Oenothera parviflora (Small-flowered evening primrose) (Oenothera cruciata)
Target Names
ndhC
Target Protein Sequence
MFLLYEYDIFWAFLIISSVIPILAFRISGLLAPTSKGPEKLSSYESGIEPMGDAWLQFRI RYYMFALVFVVFDVETIFLYPWALSFDILGVSVFIEALIFVLILVLGLVYAWRKGALEWS
Uniprot No.

Target Background

Function
NDH (NAD(P)H-quinone oxidoreductase) shuttles electrons from NAD(P)H to plastoquinone, utilizing FMN and iron-sulfur (Fe-S) centers. This process contributes to the photosynthetic electron transport chain and potentially to chloroplast respiration. In this species, plastoquinone is believed to be the primary electron acceptor. NDH couples this redox reaction to proton translocation, thus conserving redox energy as a proton gradient.
Protein Families
Complex I subunit 3 family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

Basic Research Questions

  • How is recombinant NAD(P)H-quinone oxidoreductase subunit 3 typically stored and handled in laboratory settings?

    For optimal stability, recombinant NAD(P)H-quinone oxidoreductase subunit 3 should be stored at -20°C, and for extended storage, at -80°C. The protein is typically supplied in a Tris-based buffer containing 50% glycerol optimized for stability .

    When working with this protein:

    • Avoid repeated freeze-thaw cycles by preparing working aliquots

    • Store working aliquots at 4°C for up to one week

    • Briefly centrifuge tubes before opening to avoid material loss from tube caps or sides

    • When reconstituting lyophilized protein, use sterile water or appropriate buffer as recommended

  • What is the relationship between NAD(P)H-quinone oxidoreductase subunit 3 and other subunits in the NDH complex?

    The NAD(P)H-quinone oxidoreductase complex in chloroplasts consists of multiple subunits that work together for electron transport. From the search results, we can identify several related subunits:

    SubunitUniProt IDExpected MWFunction
    NdhC (subunit 3)B0Z5B4~13 kDaMembrane component of NDH complex
    NdhB (subunit 2)P0CC32/P0CC3335 kDaCore subunit of NDH complex
    NdhG (subunit 6)B0Z5I0~20 kDaMembrane component of NDH complex
    NdhH (subunit H)P56753-145-49 kDaSubcomplex component
    NdhE (subunit 4L)B0Z5H9~11 kDaMembrane component of NDH complex

    These subunits assemble into a functional complex that spans the thylakoid membrane, facilitating electron transport from NAD(P)H to plastoquinone. NdhC (subunit 3) is thought to interact directly with NdhE and NdhG in the membrane domain of the complex .

Advanced Research Questions

  • What experimental approaches are most effective for studying protein-protein interactions between NAD(P)H-quinone oxidoreductase subunit 3 and other complex components?

    Several methodological approaches are recommended for studying protein-protein interactions within the NDH complex:

    1. Co-immunoprecipitation (Co-IP): Using antibodies against specific subunits like NdhH (AS16 4065) or NdhB (AS16 4064) to pull down associated proteins, followed by western blotting or mass spectrometry.

    2. Blue Native-PAGE: This technique preserves protein-protein interactions and can separate intact membrane protein complexes, allowing visualization of the entire NDH complex and subcomplexes.

    3. Yeast Two-Hybrid or Split-Ubiquitin Assays: Particularly useful for membrane proteins, these can identify direct interactions between NdhC and other subunits.

    4. FRET/BRET Analysis: By creating fluorescent fusion proteins with NdhC and potential interacting partners, resonance energy transfer can detect proximity in vivo.

    5. Crosslinking Mass Spectrometry: Chemical crosslinking followed by mass spectrometry can identify proteins in close proximity within the complex.

    For confirmation of interactions, researchers should employ multiple complementary techniques, as membrane protein interactions can be challenging to study with a single approach.

  • How can the enzymatic activity of recombinant NAD(P)H-quinone oxidoreductase be accurately measured in vitro?

    Measuring the enzymatic activity of NAD(P)H-quinone oxidoreductase requires specific methodological considerations:

    1. Spectrophotometric Assays: Monitor the oxidation of NAD(P)H at 340 nm in the presence of quinone substrates. The decrease in absorbance correlates with enzyme activity .

    2. Recommended Assay Conditions:

      • Buffer: 50 mM potassium phosphate (pH 7.4)

      • Temperature: 25-30°C

      • Substrates: NAD(P)H (100-200 μM) and quinone (50-100 μM)

      • Controls: Include reactions without enzyme or without substrate

    3. Potential Quinone Substrates:

      • Menadione (vitamin K3)

      • Ubiquinone (coenzyme Q)

      • 1,4-benzoquinone

      • 9,10-phenanthrenequinone (for enzymes that handle larger substrates)

    4. Data Analysis Parameters:

      • Calculate initial rates from the linear portion of progress curves

      • Determine kinetic parameters (Km, Vmax) using Michaelis-Menten equations

      • Account for potential substrate inhibition at high quinone concentrations

    The choice of quinone substrate is critical as different quinone oxidoreductases show varying substrate preferences. For example, while some enzymes efficiently reduce simple quinones like 1,4-benzoquinone, others like PcQOR from Phytophthora capsici show strong activity toward larger substrates like 9,10-phenanthrenequinone .

  • What structural features distinguish NAD(P)H-quinone oxidoreductase subunit 3 from other NDH complex components, and how do these relate to function?

    NAD(P)H-quinone oxidoreductase subunit 3 (NdhC) possesses several distinguishing structural features:

    1. Transmembrane Domains: Analysis of the amino acid sequence indicates multiple hydrophobic regions that form transmembrane helices, anchoring the protein in the thylakoid membrane .

    2. Secondary Structure Composition:

      • Predominantly α-helical (approximately 60-70%)

      • Contains several conserved charged residues (particularly lysines and arginines) at the stromal-facing regions

      • Features a characteristic "MFLLYEY" N-terminal motif

    3. Functional Domains:

      DomainApproximate PositionProposed Function
      N-terminal region1-20Membrane insertion and topology
      Central hydrophobic core21-90Membrane spanning and quinone interaction
      C-terminal region91-120Interaction with other NDH subunits
    4. Comparative Features: Unlike larger subunits such as NdhB and NdhH, which contain extensive stromal domains involved in NAD(P)H binding, NdhC is primarily involved in membrane integration and electron transfer through the complex rather than direct cofactor binding .

    These structural features position NdhC as a critical component in the membrane domain of the NDH complex, likely functioning in electron transfer rather than as a catalytic subunit.

  • What genomic approaches can be employed to study the evolution and conservation of the ndhC gene across different plant species?

    Several genomic approaches are valuable for evolutionary studies of the ndhC gene:

    1. Comparative Genomics:

      • Whole chloroplast genome sequencing across diverse plant lineages

      • Analysis of gene synteny and gene order to identify evolutionary rearrangements

      • Examination of the 56 kbp inversion region in Oenothera plastid chromosomes that may affect gene regulation

    2. Phylogenetic Analysis:

      • Maximum likelihood and Bayesian inference methods to construct evolutionary trees

      • Analysis of selection pressure (dN/dS ratios) to identify regions under positive, neutral, or purifying selection

      • Molecular clock analyses to date divergence events

    3. Population Genetics:

      • SNP mapping using techniques like Nuclease S digestion to identify polymorphisms

      • CAPS (Cleaved Amplified Polymorphic Sequence) markers for population-level variation

      • Analysis of haplotype diversity within and between closely related species

    4. Structural RNA Analysis:

      • Investigation of RNA editing sites that affect protein function

      • The search results indicate that RNA editing sites can differ between species, potentially affecting protein function

    Oenothera species provide an excellent model system for such studies due to their unique genetic properties and the extensive characterization of their plastid genomes, as documented in the literature .

  • How do mutations in NAD(P)H-quinone oxidoreductase subunit 3 affect plant photosynthetic efficiency and stress responses?

    Mutations in NAD(P)H-quinone oxidoreductase subunit 3 (ndhC) can significantly impact plant physiology in several ways:

    1. Effects on Cyclic Electron Flow:

      • Cyclic electron flow around Photosystem I is reduced

      • Decreased ATP production under high light or drought stress conditions

      • Altered ATP/NADPH ratio affecting carbon fixation efficiency

    2. Impact on Photosynthetic Parameters:

      ParameterEffect of ndhC MutationMeasurement Method
      NPQ (Non-Photochemical Quenching)Decreased capacityChlorophyll fluorescence (PAM)
      Electron Transport Rate (ETR)Reduced under stressChlorophyll fluorescence analysis
      P700 re-reduction rateSlower kineticsRedox kinetics of PSI
      CO₂ assimilationDecreased under high lightGas exchange measurements
    3. Stress Response Alterations:

      • Increased sensitivity to drought stress due to impaired water-use efficiency

      • Reduced ability to manage oxidative stress under high light conditions

      • Altered expression of stress-responsive nuclear genes through retrograde signaling

    4. Molecular Approach to Study Mutations:

      • Site-directed mutagenesis of conserved residues

      • Creation of knockout or knockdown lines using CRISPR/Cas9 or RNAi

      • Complementation studies with mutated versions to identify critical residues

      • Chlorophyll fluorescence analysis to assess functional impacts

    The proper functioning of NdhC is particularly important under stress conditions, and mutations can reveal the role of specific amino acid residues in maintaining photosynthetic efficiency.

  • What proteomics approaches are most suitable for studying the assembly and dynamics of the NDH complex containing NAD(P)H-quinone oxidoreductase subunit 3?

    Advanced proteomics approaches for studying NDH complex assembly and dynamics include:

    1. Quantitative Proteomics:

      • SILAC (Stable Isotope Labeling with Amino acids in Cell culture) to track newly synthesized proteins

      • iTRAQ or TMT labeling for multiplexed quantitative analysis across different conditions

      • Label-free quantification to compare abundance of NDH subunits under various stress conditions

    2. Structural Proteomics:

      • Hydrogen-deuterium exchange mass spectrometry (HDX-MS) to map protein-protein interfaces

      • Chemical crosslinking-MS to identify spatial proximity of subunits

      • Native mass spectrometry to determine stoichiometry and stability of subcomplexes

    3. Temporal Assembly Analysis:

      • Pulse-chase experiments combined with immunoprecipitation to track assembly intermediates

      • Ribosome profiling to investigate translation dynamics of NDH complex components

      • Time-resolved proteomics following induction of complex assembly

    4. Sample Preparation Considerations:

      • Isolation of intact thylakoid membranes using differential centrifugation

      • Solubilization with mild detergents (digitonin, n-dodecyl-β-D-maltoside)

      • Blue-native PAGE separation prior to MS analysis

      • For Western blot analysis of specific subunits:

        • Use TCA precipitation for total protein extraction

        • Employ gradient gels (e.g., 4-20%) for optimal separation

        • Follow recommended antibody dilutions (e.g., 1:5000 for NdhH)

    These approaches, when combined, provide a comprehensive view of the assembly, stoichiometry, and dynamics of the NDH complex containing the NdhC subunit.

  • How does the redox state of NAD(P)H affect the function of quinone oxidoreductases, and what methods can be used to manipulate this in experimental settings?

    The NAD(P)H redox state significantly influences quinone oxidoreductase function through several mechanisms:

    1. Mechanistic Impact of NAD(P)H/NAD(P)⁺ Ratio:

      • Higher NAD(P)H levels increase electron flow through the complex

      • NAD(P)⁺/NAD(P)H ratio affects the direction of electron transfer

      • Changes in cellular redox balance can regulate enzyme activity

    2. Experimental Methods to Manipulate Redox State:

      • Treatment with β-lapachone, a redox-cycling quinone that efficiently alters NAD(P)⁺/NAD(P)H ratios

      • Light/dark transitions to modulate photosynthetic electron transport in plant systems

      • Addition of specific inhibitors like dicoumarol for mammalian NQO1

      • Chemical modulation with H₂O₂ or DTT to alter cellular redox environments

    3. Measurement of Redox Effects:

      • Real-time monitoring of NAD(P)H fluorescence (excitation: 340 nm, emission: 460 nm)

      • Enzymatic cycling assays to determine NAD(P)⁺/NAD(P)H ratios

      • Electrochemical methods using NAD(P)H-sensitive electrodes

      • Genetically encoded fluorescent redox sensors

    4. Biological Consequences of Altered Redox State:

      Redox ChangeEffect on Quinone OxidoreductaseDownstream Consequence
      ↑ NAD(P)HEnhanced reductive capacityIncreased antioxidant protection
      ↑ NAD(P)⁺Activation of sirtuin and PARP pathwaysAltered cellular stress response
      Oscillating redoxDifferential regulation of signaling pathwaysMetabolic adaptations

    Research by Kim et al. demonstrated that β-lapachone treatment, which modulates NAD(P)⁺/NAD(P)H balance through NQO1-mediated metabolism, activated the AMP-activated protein kinase (AMPK) pathway and provided protection against various stress conditions .

  • What are the most effective expression systems for producing functional recombinant NAD(P)H-quinone oxidoreductase subunit 3 for structural studies?

    Selecting the optimal expression system for recombinant NdhC production requires consideration of several factors:

    1. Expression System Comparison:

      SystemAdvantagesDisadvantagesBest For
      E. coliHigh yield, simple cultureMembrane protein folding issuesTruncated constructs, fusion proteins
      Yeast (S. cerevisiae/P. pastoris)Post-translational modifications, membrane protein machineryLower yield than E. coliFull-length membrane proteins
      Insect cells (Sf9, Hi5)Complex eukaryotic folding machineryHigher cost, longer production timeStructural studies requiring native folding
      Plant-based (tobacco, Chlamydomonas)Native environment for chloroplast proteinsLower yields, specialized expertiseFunctional studies requiring authentic lipid environment
    2. Protein Engineering Strategies:

      • Addition of purification tags (His₆, GST, MBP) at termini least likely to disrupt function

      • Truncation of terminal regions to improve expression while maintaining core structure

      • Fusion with GFP to monitor expression and folding quality

      • Addition of solubility-enhancing partners for membrane proteins

    3. Optimized Production Protocol:

      • For E. coli: Use specialized strains (C41, C43) designed for membrane protein expression

      • Induce at lower temperatures (16-20°C) to improve folding

      • Include stabilizing additives (glycerol, specific detergents) in lysis buffers

      • Use mild solubilization conditions to maintain native structure

    4. Purification Considerations:

      • Two-step purification (affinity followed by size exclusion chromatography)

      • Detergent screening to identify optimal solubilization conditions

      • Lipid nanodisc or amphipol reconstitution for structural studies

    The strategy should be tailored to the intended experimental application, with structural studies requiring the highest purity and conformational homogeneity.

  • How can researchers investigate the role of NAD(P)H-quinone oxidoreductase in plant responses to environmental stress conditions?

    Investigating the role of NAD(P)H-quinone oxidoreductase in stress responses requires a multi-faceted approach:

    1. Stress Exposure Protocols:

      • High light stress (800-1500 μmol photons m⁻² s⁻¹ for 2-6 hours)

      • Drought stress (withholding water until specific soil moisture content)

      • Temperature stress (4°C for cold or 40°C for heat stress)

      • Combined stresses to mimic natural conditions

    2. Physiological Measurements:

      • Chlorophyll fluorescence parameters using Pulse Amplitude Modulation (PAM) fluorometry

      • P700 absorbance changes to monitor PSI redox state

      • Gas exchange measurements (photosynthesis, transpiration, water-use efficiency)

      • ROS production using fluorescent probes or histochemical staining

    3. Molecular and Biochemical Analyses:

      • Expression analysis of NDH subunits using real-time PCR

      • Protein abundance using Western blotting with specific antibodies

      • Enzyme activity assays under different stress conditions

      • Post-translational modification profiling (phosphorylation, redox modifications)

    4. Genetic Approaches:

      • Generation of knockout/knockdown lines for NdhC

      • Complementation with wildtype or mutated versions

      • Overexpression studies to assess potential stress tolerance enhancement

      • CRISPR/Cas9 base editing for targeted amino acid substitutions

    5. Multi-Omics Integration:

      • Transcriptomics to identify stress-responsive gene networks

      • Metabolomics to analyze changes in redox-related metabolites

      • Proteomics to determine protein-protein interaction changes under stress

    These methods, when combined, provide a comprehensive understanding of how NAD(P)H-quinone oxidoreductase contributes to plant stress adaptations and which specific aspects of its function are most critical during environmental challenges.

Research Applications and Future Directions

  • What potential biotechnological applications could arise from research on NAD(P)H-quinone oxidoreductase subunit 3 and related proteins?

    Research on NAD(P)H-quinone oxidoreductase subunit 3 and related proteins offers several promising biotechnological applications:

    1. Crop Improvement:

      • Engineering plants with enhanced NDH complex function for improved drought tolerance

      • Modifying cyclic electron flow for better photosynthetic efficiency under fluctuating light conditions

      • Creating stress-resistant crop varieties through targeted modifications of NDH subunits

    2. Biocatalysis and Green Chemistry:

      • Development of biocatalysts for detoxification of quinone-containing environmental pollutants

      • Enzyme-based sensors for detecting quinones and related compounds

      • Bioremediation applications targeting quinone-based industrial waste

    3. Pharmaceutical Applications:

      • Drug screening platforms targeting quinone oxidoreductases for disease treatment

      • Identification of compounds that modulate NAD(P)⁺/NAD(P)H balance for therapeutic purposes

      • Development of enzyme inhibitors or activators as potential therapeutics

    4. Renewable Energy:

      • Bio-inspired design of artificial photosynthetic systems for energy production

      • Incorporation of modified enzymes into biofuel cells

      • Engineering of photosynthetic organisms for enhanced biofuel production

    The unique electron transport properties of these enzymes, combined with their roles in stress responses, make them valuable targets for multiple biotechnological applications across different sectors.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.