Recombinant Oenothera parviflora NAD (P)H-quinone oxidoreductase subunit 4L, chloroplastic

What is Oenothera parviflora NAD(P)H-quinone oxidoreductase subunit 4L and what is its primary function?

The NAD(P)H-quinone oxidoreductase subunit 4L from Oenothera parviflora (small-flowered evening primrose) is a chloroplastic protein involved in electron transfer processes. This protein belongs to a family of enzymes that catalyze the transfer of electrons from NAD(P)H to quinones, which is essential for various cellular processes including detoxification mechanisms. The protein functions as part of the NAD(P)H dehydrogenase complex in the chloroplast, contributing to alternative electron transport pathways in photosynthesis. The enzyme's ability to facilitate electron transfer helps protect plant cells from oxidative stress by preventing the formation of reactive oxygen species through quinone redox cycling .

What are the key molecular characteristics of this protein?

The recombinant form of Oenothera parviflora NAD(P)H-quinone oxidoreductase subunit 4L consists of 101 amino acids (full length: 1-101). The protein has a UniProt ID of B0Z5H9 and is encoded by the ndhE gene. Its amino acid sequence is: MILEHVLVLSAYLFSIGIYGLITSRNMVRALMCLELILNSVNLNFVTFSDFFDSRQLKGDIFSIFIIAIAAAEAAIGLAIVSSIYRNRKSIRINQSNLLNK . When produced recombinantly, it is typically fused to an N-terminal His-tag to facilitate purification. The protein's structure features transmembrane domains characteristic of proteins that function within membrane systems, which is consistent with its localization and role in the chloroplast electron transport chain .

How does this protein relate to the broader family of NAD(P)H:quinone oxidoreductases?

While the Oenothera parviflora subunit 4L is a specific component of the chloroplastic NAD(P)H dehydrogenase complex, it shares functional similarities with other NAD(P)H:quinone oxidoreductases. These enzymes generally catalyze the two-electron reduction of quinones and their derivatives, which serves as a detoxification mechanism. NAD(P)H:quinone oxidoreductases, such as NQO1 and NQO2 in mammals, protect cells against redox cycling, oxidative stress, and potentially neoplasia . The chloroplastic version in plants likely evolved to fulfill specialized roles in photosynthetic organisms, but the fundamental chemistry of electron transfer from NAD(P)H to quinone substrates is conserved across various forms of these enzymes. Unlike soluble forms found in other organisms, the chloroplastic subunit 4L is membrane-associated and functions as part of a larger multi-subunit complex .

What expression systems are optimal for producing this recombinant protein?

Based on available data, E. coli has been successfully used as an expression system for recombinant Oenothera parviflora NAD(P)H-quinone oxidoreductase subunit 4L with an N-terminal His-tag . When designing an expression protocol, researchers should consider:

• Codon optimization for E. coli expression, as plant genes often contain codons rarely used in bacteria

• Selection of appropriate promoters (T7 promoter systems are commonly used for heterologous protein expression)

• Optimization of induction conditions (temperature, IPTG concentration, and induction time)

• Consideration of inclusion body formation and potential solubility issues

For membrane-associated proteins like subunit 4L, expression conditions might need adjustment to prevent aggregation. Using E. coli strains designed for membrane protein expression (such as C41(DE3) or C43(DE3)) could improve soluble protein yields. Alternatively, cell-free protein expression systems may be considered for challenging membrane proteins .

What purification strategies yield the highest purity for this recombinant protein?

The recommended purification strategy for His-tagged Oenothera parviflora NAD(P)H-quinone oxidoreductase subunit 4L would involve:

• Immobilized Metal Affinity Chromatography (IMAC) using Ni-NTA or similar resins as the primary purification step

• Optimization of imidazole concentrations in wash and elution buffers to minimize non-specific binding

• Size exclusion chromatography as a polishing step to achieve >90% purity

• Consideration of detergent selection if the membrane-associated nature of the protein causes solubility issues

For functional studies, researchers should verify that the purification process preserves the protein's native conformation and activity. Inclusion of stabilizing agents such as glycerol (5-50%) in the purification buffers can help maintain protein stability. The final purified product should be assessed by SDS-PAGE to confirm purity greater than 90% .

How should the protein be properly stored and reconstituted to maintain activity?

For optimal storage and reconstitution of Oenothera parviflora NAD(P)H-quinone oxidoreductase subunit 4L:

Store the lyophilized protein at -20°C to -80°C. For working aliquots, 4°C storage is suitable for up to one week, but repeated freeze-thaw cycles should be avoided as they can compromise protein integrity. When reconstituting the protein, briefly centrifuge the vial to bring contents to the bottom, then add deionized sterile water to achieve a concentration of 0.1-1.0 mg/mL .

For long-term storage of reconstituted protein, add glycerol to a final concentration of 5-50% (with 50% being standard) and store in aliquots at -20°C or -80°C. This helps prevent protein denaturation during freeze-thaw cycles. The recommended storage buffer is Tris/PBS-based with 6% trehalose at pH 8.0, which provides additional stability to the protein structure .

What methodologies can be used to assess the enzymatic activity of this protein?

Several complementary approaches can be used to assess the enzymatic activity of Oenothera parviflora NAD(P)H-quinone oxidoreductase subunit 4L:

• Spectrophotometric assays: Monitor the oxidation of NAD(P)H at 340 nm in the presence of various quinone substrates. This allows calculation of kinetic parameters including Km and Vmax for different substrates.

• Oxygen consumption measurements: Using an oxygen electrode to measure rates of oxygen consumption during enzyme-catalyzed reactions.

• High-Performance Liquid Chromatography (HPLC): To separate and quantify reaction products and substrates.

• Electron Paramagnetic Resonance (EPR) spectroscopy: For detection of semiquinone radical intermediates during the reaction.

When designing enzymatic assays, researchers should test multiple quinone substrates of varying sizes, as structural studies of homologous enzymes suggest that quinone oxidoreductases can exhibit substrate preference based on molecular size. For example, in the homologous PcQOR enzyme, larger substrates like 9,10-phenanthrenequinone showed higher activity compared to smaller molecules like 1,4-benzoquinone .

How does the substrate specificity of this enzyme compare to other quinone oxidoreductases?

While specific data on substrate specificity for Oenothera parviflora NAD(P)H-quinone oxidoreductase subunit 4L is limited, insights can be drawn from studies of homologous enzymes. Research on quinone oxidoreductases from other organisms indicates that substrate specificity is influenced by the architecture of the active site and substrate-binding pocket.

Studies on Phytophthora capsici QOR (PcQOR) revealed that it has strong reduction activity toward large substrates such as 9,10-phenanthrenequinone but weaker activity with smaller substrates like 1,4-benzoquinone . This specificity is attributed to the wider substrate-binding site in PcQOR compared to homologs from E. coli and Thermus thermophilus.

For the Oenothera parviflora enzyme, researchers should systematically evaluate various quinone substrates differing in size, hydrophobicity, and redox potential to establish its specificity profile. Understanding this specificity is crucial for elucidating the protein's physiological role in chloroplast metabolism and stress responses .

What role does this protein play in plant stress responses?

NAD(P)H-quinone oxidoreductases play important roles in protecting cells against oxidative stress by catalyzing the two-electron reduction of quinones, thereby preventing one-electron reduction that would lead to the formation of reactive oxygen species (ROS) through redox cycling .

In plants, the chloroplastic NAD(P)H-quinone oxidoreductase complex, of which subunit 4L is a component, likely contributes to:

• Protection against photooxidative stress by providing alternative electron transport pathways

• Detoxification of quinones formed during photosynthesis under stress conditions

• Maintenance of redox balance within the chloroplast

• Potential roles in plant adaptation to environmental stressors such as high light, drought, or temperature extremes

Research methodologies to investigate these roles could include:

• Comparative gene expression analysis under various stress conditions

• Generation of knockout or knockdown plant lines using CRISPR-Cas9 or RNAi approaches

• Measurement of ROS production and oxidative damage markers in wild-type versus modified plants

• Physiological studies examining photosynthetic parameters under stress conditions

What structural features determine the function of this enzyme in electron transfer?

While the specific structure of Oenothera parviflora NAD(P)H-quinone oxidoreductase subunit 4L has not been fully characterized, insights from homologous enzymes provide valuable understanding of structure-function relationships. Quinone oxidoreductases typically exhibit a bi-modular architecture with:

• A NADPH-binding groove that recognizes and positions the cofactor

• A substrate-binding pocket that accommodates the quinone molecule

• Specific residues at the interface that facilitate electron transfer

Crystal structure analysis of homologous enzymes, such as PcQOR, reveals that these proteins contain a conserved topology despite variations in active site architecture. The enzyme's ability to transfer electrons is dependent on the precise positioning of the quinone substrate relative to the nicotinamide ring of NADPH. Key residues that coordinate substrate binding and catalysis include conserved arginine, glutamine, tyrosine, cysteine, and threonine residues that form hydrogen bonds with the quinone .

The increased hydrophobicity around the positively charged nicotinamide cavity has been shown to stimulate electron transfer from NADPH to the substrate in the ternary enzyme-NADPH-substrate complex. This structural arrangement is critical for the enzyme's catalytic function .

How do mutations in conserved residues affect the enzyme's function?

Mutations in conserved residues can significantly impact the function of NAD(P)H-quinone oxidoreductases through various mechanisms:

• Alteration of cofactor binding: Mutations in the NADPH-binding domain can affect cofactor affinity and orientation, directly impacting electron transfer efficiency.

• Changes in substrate specificity: Modifications to the substrate-binding pocket can alter the enzyme's preference for different quinone structures. Studies of homologous enzymes have shown that residues such as R45, Q48, Y54, C147, and T148 play crucial roles in substrate recognition and binding .

• Disruption of catalytic mechanism: Key residues involved in the electron transfer pathway, when mutated, can reduce or eliminate enzymatic activity even when substrate and cofactor binding remain intact.

To investigate the effects of mutations, researchers can employ site-directed mutagenesis coupled with activity assays and structural analysis. Computational simulation approaches, including molecular dynamics and quantum mechanics/molecular mechanics (QM/MM) calculations, can provide insights into the effects of mutations on enzyme function before experimental validation .

What is the proposed catalytic mechanism for this class of enzymes?

Based on structural studies of homologous NAD(P)H-quinone oxidoreductases, a catalytic mechanism has been proposed that likely applies to the Oenothera parviflora enzyme as well:

• When a quinone substrate enters the active site, it is positioned by interactions with specific amino acid residues (such as arginine, glutamine, and tyrosine) and the nicotinamide ring of NADPH.

• The phenyl ring of the quinone stacks against the nicotinamide ring, creating an optimal geometry for electron transfer.

• The hydrophobic environment around the positively charged nicotinamide cavity facilitates electron transfer from NADPH to the quinone substrate in the ternary enzyme-NADPH-substrate complex.

• Following reduction of the quinone carbonyl groups, the hydrogen bonds between the quinone and the protein residues are broken.

• As the reduction reaction completes, the substrate-binding pocket opens to release the reduced product (hydroquinone).

This two-electron reduction mechanism is favored over one-electron reduction, thereby preventing the formation of semiquinone radicals that would contribute to oxidative stress .

How does Oenothera parviflora NAD(P)H-quinone oxidoreductase compare to homologs in other species?

Comparing the Oenothera parviflora enzyme to homologs in other species reveals insights into evolutionary conservation and specialization:

Research methodologies for comparative analysis should include sequence alignment, homology modeling, heterologous expression of homologs, and comparative biochemical characterization to identify conserved and divergent features.

What evolutionary insights can be gained from studying this protein across different plant species?

Evolutionary analysis of NAD(P)H-quinone oxidoreductase across plant species can provide valuable insights into:

• Adaptation to photosynthetic lifestyles: Comparing the enzyme across various plant lineages can reveal how it has been adapted for specific photosynthetic mechanisms and environmental niches.

• Co-evolution with photosynthetic apparatus: Understanding how the enzyme has evolved alongside other components of the photosynthetic machinery provides insights into the integration of redox systems in chloroplasts.

• Selection pressures: Identifying regions of high conservation versus variability can highlight functional constraints and adaptable features, respectively.

• Acquisition of specialized functions: Some plant species may have evolved specific adaptations in this enzyme to handle unique environmental stressors or metabolic requirements.

Research approaches should include phylogenetic analysis of homologous sequences, ancestral sequence reconstruction, and correlation of enzyme properties with ecological niches. Comparative genomics across plant lineages can also reveal patterns of gene duplication, loss, or modification that provide insights into the evolutionary trajectory of this important enzyme family .

What are common issues in expressing and purifying this recombinant protein?

Researchers working with recombinant Oenothera parviflora NAD(P)H-quinone oxidoreductase subunit 4L may encounter several challenges:

• Poor expression yields: As a membrane-associated chloroplastic protein, expression in bacterial systems may result in inclusion body formation or toxicity to the host cells. To address this:

  • Optimize growth temperature (typically lowering to 16-20°C)

  • Reduce inducer concentration

  • Consider specialized E. coli strains designed for membrane proteins

  • Explore fusion partners that enhance solubility (MBP, SUMO, etc.)

• Protein instability: The protein may show instability during purification due to its native membrane environment being absent. Solutions include:

  • Addition of appropriate detergents during cell lysis and purification

  • Inclusion of stabilizing agents like glycerol (5-50%) and trehalose (6%)

  • Maintaining cold temperatures throughout purification

  • Using protease inhibitors to prevent degradation

• Loss of cofactors: NAD(P)H-quinone oxidoreductases require proper cofactor association for activity. Ensure:

  • Addition of appropriate cofactors during purification

  • Verification of cofactor binding through spectroscopic methods

• Aggregation during concentration: Use gentle concentration methods and optimize buffer conditions to prevent aggregation. Consider including non-ionic detergents or amphipols if necessary .

How can researchers troubleshoot low enzymatic activity in recombinant preparations?

When facing low enzymatic activity in recombinant Oenothera parviflora NAD(P)H-quinone oxidoreductase preparations, consider these approaches:

• Verify protein folding and integrity:

  • Use circular dichroism (CD) spectroscopy to assess secondary structure

  • Employ thermal shift assays to evaluate protein stability

  • Check for proteolytic degradation via SDS-PAGE or mass spectrometry

• Optimize assay conditions:

  • Test different pH values (typically pH 6.0-8.5)

  • Vary buffer compositions and ionic strengths

  • Evaluate temperature dependence of activity

  • Ensure sufficient NADPH concentrations

  • Test multiple quinone substrates, as substrate specificity may be narrower than expected

• Assess cofactor binding:

  • Verify NADPH binding through fluorescence quenching assays

  • Consider adding FAD or FMN if the enzyme requires flavin cofactors

  • Evaluate metal ion requirements if applicable

• Control for inhibitors:

  • Check for the presence of inhibitory compounds from the expression system

  • Dialyze extensively to remove potential inhibitors

  • Test activity in the presence of reducing agents like DTT or β-mercaptoethanol

• Consider protein modifications:

  • Evaluate the impact of the His-tag on enzyme activity

  • Consider tag removal if it interferes with activity

  • Assess potential post-translational modifications required for activity

What controls should be included in functional assays using this protein?

Robust functional assays for Oenothera parviflora NAD(P)H-quinone oxidoreductase subunit 4L should include these essential controls:

• Negative controls:

  • Buffer-only reaction (no enzyme) to control for non-enzymatic reduction

  • Heat-inactivated enzyme to control for non-specific activity

  • Purified protein from empty vector expression to control for host cell contaminants

• Positive controls:

  • Commercial quinone reductase (if available) to validate assay conditions

  • Well-characterized homologous enzyme as a reference point

• Substrate controls:

  • NADPH stability control (NADPH in buffer over time)

  • Quinone substrate stability in assay conditions

  • Alternative electron donors to verify specificity

• Inhibition controls:

  • Known inhibitors of quinone reductases (if applicable)

  • Varying concentrations of substrates to establish kinetic parameters

  • Metal chelators to test metal dependency

• Assay validation controls:

  • Linearity with respect to enzyme concentration

  • Time course to ensure measurements within linear range

  • Multiple detection methods to confirm activity (e.g., spectrophotometric plus HPLC)

Including these controls will help distinguish genuine enzymatic activity from artifacts and provide a comprehensive characterization of the recombinant protein's functionality .

How can advanced structural biology techniques enhance our understanding of this protein?

Advanced structural biology techniques can provide crucial insights into the function and mechanism of Oenothera parviflora NAD(P)H-quinone oxidoreductase subunit 4L:

• Cryo-electron microscopy (cryo-EM):

  • Enables visualization of the protein within its native membrane environment

  • Allows study of the entire NAD(P)H dehydrogenase complex architecture

  • Can capture different conformational states during the catalytic cycle

• X-ray crystallography with substrate analogs:

  • Provides atomic-resolution details of substrate and cofactor binding

  • Enables visualization of key catalytic residues

  • Helps identify structural elements that determine substrate specificity

• Nuclear Magnetic Resonance (NMR) spectroscopy:

  • Offers insights into protein dynamics in solution

  • Can detect conformational changes upon substrate binding

  • Useful for studying protein-protein interactions within the complex

• Hydrogen-deuterium exchange mass spectrometry (HDX-MS):

  • Maps protein flexibility and solvent accessibility

  • Identifies regions involved in conformational changes during catalysis

  • Less dependent on protein size limitations than NMR

• Single-molecule FRET:

  • Monitors conformational dynamics during the catalytic cycle

  • Provides information on the heterogeneity of protein states

  • Can detect transient intermediates missed by ensemble methods

These techniques would allow researchers to move beyond sequence-based analysis to a detailed structural understanding of how this protein functions within the chloroplast electron transport system .

What approaches can be used to investigate the role of this protein in response to environmental stressors?

To investigate the role of Oenothera parviflora NAD(P)H-quinone oxidoreductase subunit 4L in environmental stress responses, researchers can employ these methodologies:

• Transcriptomic and proteomic profiling:

  • RNA-seq analysis to measure gene expression changes under various stressors

  • Quantitative proteomics to assess protein abundance changes

  • Phosphoproteomics to identify potential regulatory modifications

• Genetic manipulation approaches:

  • CRISPR-Cas9 gene editing to create knockout or knockdown lines

  • Overexpression studies to assess gain-of-function effects

  • Site-directed mutagenesis of key residues to create plants with altered enzyme activity

• Physiological measurements:

  • Chlorophyll fluorescence to assess photosynthetic efficiency

  • ROS detection using fluorescent probes

  • Measurement of antioxidant metabolites and enzymes

  • Lipid peroxidation assays to quantify oxidative damage

• Omics integration:

  • Metabolomics to identify changes in quinone and antioxidant metabolites

  • Integration of transcriptomic, proteomic, and metabolomic data for systems-level understanding

• Environmental simulation chambers:

  • Controlled exposure to specific stressors (high light, drought, temperature)

  • Recovery experiments to assess resilience mechanisms

  • Combined stress treatments to mimic natural conditions

These approaches would help elucidate how this protein contributes to plant stress tolerance and identify potential applications in improving crop resistance to environmental challenges .

How might this protein's activity be modulated for biotechnological applications?

The potential biotechnological applications for modulating Oenothera parviflora NAD(P)H-quinone oxidoreductase activity include:

• Engineering stress-tolerant crops:

  • Overexpression or optimization of the enzyme to enhance detoxification capacity

  • Creation of synthetic variants with improved catalytic efficiency

  • Tissue-specific expression to protect sensitive plant structures

• Bioremediation applications:

  • Engineering plants with enhanced capacity to detoxify environmental pollutants

  • Targeting specific quinone-based contaminants through enzyme engineering

  • Creating biosensors for detecting quinone compounds in soil or water

• Metabolic engineering:

  • Redirecting electron flow in photosynthetic organisms for improved biofuel production

  • Enhancing redox balance in engineered metabolic pathways

  • Coupling quinone reduction to valuable metabolite production

• Protein engineering approaches:

  • Rational design based on structural insights to modify substrate specificity

  • Directed evolution to generate enzymes with novel properties

  • Computational design of improved variants using machine learning algorithms

• Synthetic biology integration:

  • Incorporation into synthetic electron transport chains

  • Creation of hybrid systems combining plant and microbial components

  • Development of light-responsive biocatalytic systems

These applications would build upon fundamental knowledge of the enzyme's structure and function to create biotechnological solutions addressing agricultural, environmental, and industrial challenges .