Recombinant Oenothera parviflora Photosystem II CP47 chlorophyll apoprotein (psbB)

Shipped with Ice Packs
In Stock

Description

Research Findings on psbB Operon Regulation

Studies in Oenothera hybrids reveal the psbB operon’s role in chloroplast-nuclear incompatibility under high-light (HL) stress :

Transcriptional Regulation

  • A 144 bp deletion 7 bp upstream of the psbB operon’s −35 promoter region disrupts transcription under HL conditions, reducing mRNA levels of psbB, psbT, psbH, petB, and petD .

  • Mechanism: The deletion likely impedes binding of auxiliary proteins (e.g., sigma factors) rather than RNA polymerase itself, causing light-dependent transcriptional repression .

Interaction with pbf1

  • The antisense pbf1 transcript (involved in PSI/PSII assembly) is downregulated in incompatible hybrids due to sense-antisense pairing with psbT mRNA .

  • Consequence: Reduced Pbf1 protein levels exacerbate PSII instability under HL, contributing to hybrid lethality .

Applications in Photosynthesis Research

  • PSII Assembly Studies: CP47 is essential for PSII’s structural integrity; recombinant forms enable mutational analyses to dissect chlorophyll-binding domains .

  • Hybrid Incompatibility Models: Used to study plastid-nuclear epistasis in Oenothera, highlighting evolutionary constraints on chloroplast genome architecture .

  • Biophysical Characterization: Facilitates spectroscopic studies on energy transfer mechanisms due to high purity and stability .

Limitations and Considerations

  • Partial Protein Length: Most commercial variants are truncated, potentially lacking native conformational properties .

  • Tagging Variability: His-tag or other tags may interfere with functional assays; tagless versions are preferred for structural studies .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer components, temperature, and inherent protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C; lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is finalized during production. If you require a particular tag, please specify it in your order; we will prioritize its incorporation.
Synonyms
psbB; Photosystem II CP47 reaction center protein; PSII 47 kDa protein; Protein CP-47
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-508
Protein Length
full length protein
Species
Oenothera parviflora (Small-flowered evening primrose) (Oenothera cruciata)
Target Names
psbB
Target Protein Sequence
MGLPWYRVHTVVLNDPGRLLAVHIMHTALVAGWAGSMALYELAVFDPSDPVLDPMWRQGM FVIPFMTRLGITNSWGGWSITGGTVTNPGIWSYEGVAGSHILFSGLCFLAAIWHWVYWDL AIFSDERTGKPSLDLPKIFGIHLFLSGLACFGFGAFHVTGLYGPGIWVSDPYGLTGEVQP VNPAWGVEGFDPFVPGGIASHHIAAGTLGILAGLFHLSVRPPQRLYKGLRMGNIETVLSS SIAAVFFAAFVVAGTMWYGSATTPIELFGPTRYQWDQGYFQQEIYRRVGAGLAKNQSLSE AWSKIPEKLAFYDYIGNNPAKGGLFRAGSMDSGDGIAVGWLGHPIFRDKEGRELFVRRMP TFFETFPVVLVDGDGIVRADVPFRRAESKYSVEQVGVTVEFYGGELNGVSYSDPATVKKY ARRAQLGEIFELDRATLKSDGVFRSSPRGWFTFGHASFALLFFFGHIWHGARTLFRDVFA GIDPDLDTQVEFGAFQKLGDPTTRRQAV
Uniprot No.

Target Background

Function

A core component of the Photosystem II (PSII) complex, this chlorophyll-binding protein is crucial for catalyzing the initial light-driven photochemical reactions. PSII, a light-driven water:plastoquinone oxidoreductase, uses light energy to extract electrons from water (H₂O), producing oxygen (O₂) and a proton gradient used for ATP synthesis.

Protein Families
PsbB/PsbC family, PsbB subfamily
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the psbB gene and what does it encode?

The psbB gene encodes the intrinsic chlorophyll protein CP47 (also called CPa-1), which functions as a core component of photosystem II in higher plants, algae, and cyanobacteria. This protein is essential for photosynthesis as it plays a critical role in light harvesting and energy transfer within the photosystem II complex. CP47 is one of the major chlorophyll-binding proteins in the photosynthetic apparatus, helping to funnel excitation energy to the reaction center where photochemistry occurs .

What is the role of the psbB operon in photosynthesis?

The psbB operon is a multi-gene cluster in the chloroplast genome that includes genes essential for photosystem II function. Despite not encoding PSI-related genes, the psbB operon's transcriptional regulation influences both photosystems. Research with Oenothera species has demonstrated that the psbB operon is particularly important in plastome-genome compatibility, with misregulation of this operon leading to photosynthetic deficiencies. The operon contains a highly conserved promoter region that responds to light conditions, serving as a regulatory hub for photosynthetic gene expression .

How does chlorophyll availability affect CP47 apoprotein stability?

Chlorophyll-binding apoproteins like CP47 are highly unstable in the absence of chlorophyll, though this instability results from post-translational degradation rather than translational regulation. Experiments have provided strong evidence that chlorophyll-binding apoproteins synthesize at normal rates without chlorophyll but quickly degrade if chlorophyll is unavailable for binding. Several thylakoid membrane proteases are involved in chlorophyll apoprotein processing and homeostasis, functioning to adjust apoprotein levels to chlorophyll availability .

Why is Oenothera parviflora a significant model system for studying psbB?

Oenothera species, including O. parviflora, have become valuable model systems for studying plastome-genome incompatibility due to their unique genetic features. The genus exhibits plastome-genome incompatibility that affects photosynthetic efficiency, with the psbB operon being a major locus for this incompatibility. This makes recombinant O. parviflora psbB proteins particularly useful for investigating how nuclear-plastid interactions affect photosystem II assembly and function in different genetic backgrounds .

How does the CP47 protein engage with the thylakoid membrane during synthesis?

The CP47 protein engages with the thylakoid membrane co-translationally, meaning it begins to integrate into the membrane while still being synthesized by the ribosome. Research examining ribosome footprints in membrane and soluble fractions has revealed that the position at which nascent CP47 apoprotein engages the thylakoid membrane is not influenced by chlorophyll deficiency. This suggests that initial membrane engagement occurs through the first transmembrane segment before chlorophyll attachment. Terminal chlorophyll synthesis enzymes are associated with the thylakoid membrane, enabling chlorophyll attachment to apoproteins only after their initial membrane engagement .

What molecular mechanisms explain the light-dependent regulation of the psbB operon?

The light-dependent regulation of the psbB operon involves complex interactions between promoter elements and regulatory proteins. In Oenothera, a 144 bp deletion in the spacer region near the psbB operon promoter affects its regulation in a light-dependent manner. While this deletion does not affect the TATA box, it resides 7 bp upstream of the -35 box, suggesting that binding of auxiliary proteins such as sigma factors may be impaired rather than core polymerase binding. The same promoter is used in all genetic backgrounds, as evidenced by mapping of transcription start sites, which are highly conserved between species .

How do mutations in the psbB gene affect photosystem II function?

Site-directed mutagenesis studies have revealed critical functional domains within the CP47 protein. For instance, the R448G mutation in the large extrinsic loop E of CP47 in Synechocystis sp. PCC 6803 produces a strain with significantly impaired photosystem II activity. This mutant grows photoautotrophically at only about 50% the rate of control strains and exhibits 63% of normal photosystem II activity. Quantum yield measurements at low light intensities indicate this mutant has only 55% of the fully functional photosystem II centers found in control strains. Additionally, upon exposure to high light intensities, the mutant strain exhibits a 2.2-fold increase in photoinactivation rate, demonstrating the critical role of specific CP47 residues in photosystem II stability and photoprotection .

What is the electronic structure of CP47 and how does it influence energy transfer?

The CP47 antenna complex exhibits distinct spectroscopic features that reveal its electronic structure. Low-temperature optical spectra of isolated CP47 from Photosystem II show that the lowest Qy state in absorption (A1) is characterized by electron-phonon coupling with a Huang-Rhys factor of approximately 1 and an inhomogeneous width of about 180 cm-1. The mean phonon frequency of the A1 band is 20 cm-1. Chlorophylls in intact CP47 are efficiently connected via excitation energy transfer to the A1 trap near 693 nm, and the position of the fluorescence maximum depends on burn fluence—specifically, the 695 nm fluorescence maximum shifts blue with increasing fluence. These electronic properties are crucial for understanding how CP47 functions in light harvesting and energy transfer within photosystem II .

How can researchers reconcile conflicting data about chlorophyll's effect on apoprotein synthesis?

  • Recognize the technical limitations of pulse-labeling assays in distinguishing between reduced synthesis and rapid turnover

  • Implement complementary methodologies such as ribosome profiling to directly measure translation

  • Design experiments that can temporally separate translation events from degradation processes

  • Consider tissue-specific and developmental context, as different mechanisms may apply during biogenesis versus repair cycles

What explains the differential effects of ion depletion on wild-type versus psbB mutants?

Research with the R448G mutant of the psbB gene revealed dramatic sensitivity to chloride depletion compared to wild-type strains. When grown in chloride-deficient media (20 μM chloride), the mutant strain exhibited little to no growth while control strains grew at nearly normal rates. This differential response suggests that:

  • The CP47 protein likely plays a role in maintaining ion homeostasis within photosystem II

  • Structural changes in the mutant CP47 may alter binding sites for chloride ions that are essential for water oxidation

  • The mutation may disrupt interactions with other photosystem II components that coordinate chloride

  • Alternative ions (like bromide) can functionally substitute for chloride, as evidenced by restored growth rates when 480 μM bromide was added to chloride-deficient media

How should genetic incompatibility data from Oenothera be interpreted?

The AB-I incompatibility in Oenothera hybrids demonstrates complex interactions between plastid and nuclear genomes. When interpreting such data, researchers should consider that:

  • Multiple genetic loci may contribute to the incompatibility phenotype with varying importance

  • The psbB operon deletion affects promoter regulation in a light-dependent manner specifically in the AB genetic background

  • Transcriptional misregulation of one operon (psbB) can have pleiotropic effects on seemingly unrelated components (PSI)

  • Antisense interactions between transcripts (e.g., psbB operon and pbf1) may create regulatory complexities not apparent from gene sequence analysis alone

This suggests a model where incompatibility arises from mismatches in the co-evolution of nuclear-encoded regulatory factors with plastid promoter regions, potentially involving sigma factors that interact with RNA polymerase .

What techniques are most effective for studying CP47 function?

Methodological ApproachApplicationAdvantagesLimitations
Site-directed mutagenesisIdentify functional domains and critical residuesPrecise modification of specific residuesMay not reveal complex interactions between distant regions
Ribosome profilingStudy translation dynamics and membrane engagementDirect measurement of ribosome positions on mRNALimited temporal resolution
Spectroscopic analysisCharacterize electronic structure and energy transferNon-invasive measurement of functional propertiesRequires specialized equipment and expertise
Pulse-chase labelingTrack protein synthesis and turnoverCan follow proteins from synthesis through degradationDifficulty distinguishing lack of synthesis from rapid turnover
Comparative genomicsIdentify conserved regions across speciesReveals evolutionarily important domainsMay miss species-specific adaptations

When investigating CP47 function, researchers should employ multiple complementary approaches. For instance, combining site-directed mutagenesis with spectroscopic analysis can reveal how specific residues influence energy transfer properties. Similarly, ribosome profiling coupled with pulse-chase experiments can clarify the relationship between translation, membrane integration, and protein stability .

How can researchers distinguish between translation defects and rapid protein turnover?

Distinguishing between reduced translation and enhanced degradation of proteins like CP47 presents a significant methodological challenge. To address this, researchers should implement a multi-faceted approach:

  • Use ribosome profiling to directly measure ribosome occupancy on mRNAs, providing a snapshot of translation independent of protein stability

  • Employ protease inhibitors selectively to determine if apparent synthesis defects can be rescued by blocking degradation

  • Develop reporter systems that allow real-time monitoring of both translation and protein accumulation

  • Perform in vitro translation assays with isolated chloroplasts under controlled conditions to eliminate cellular degradation machinery

  • Compare translation rates in the presence of chlorophyll synthesis inhibitors versus protease inhibitors to differentiate between effects on synthesis versus stability

What approaches can optimize recombinant CP47 expression for structural studies?

Obtaining sufficient quantities of properly folded recombinant CP47 presents challenges due to its complex membrane integration and chlorophyll-binding properties. Researchers can optimize expression through:

  • Selection of expression systems with intact chlorophyll synthesis pathways or co-expression with chlorophyll biosynthesis enzymes

  • Development of membrane-mimetic environments that support proper folding

  • Creation of fusion constructs with solubility-enhancing tags that can be removed post-purification

  • Optimization of detergent types and concentrations for extraction and purification

  • Implementation of high-throughput screening methods to identify conditions that maximize yield of correctly folded protein

These approaches should be tailored based on the intended application, with structural studies requiring highly pure, homogeneous preparations while functional studies may tolerate more heterogeneous samples .

How can photosystem assembly be monitored in vivo?

Monitoring the assembly of CP47 into functional photosystem II complexes requires techniques that can track this process in living cells or intact chloroplasts. Effective approaches include:

  • Fluorescence recovery after photobleaching (FRAP) with fluorescently tagged CP47 to monitor mobility and incorporation into complexes

  • Time-resolved spectroscopy to measure energy transfer kinetics during assembly

  • Blue-native gel electrophoresis combined with western blotting to identify assembly intermediates

  • Pulse-chase labeling with detection of CP47 in differently sized complexes over time

  • Cryo-electron microscopy of thylakoid membranes at different stages of chloroplast development

These techniques provide complementary information about the temporal sequence, spatial organization, and functional consequences of CP47 assembly into photosystem II, allowing researchers to identify rate-limiting steps and regulatory points in the assembly process .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.