Recombinant Oenothera parviflora Photosystem Q (B) protein

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Oenothera parviflora Photosystem Q(B) Protein

The Recombinant Oenothera parviflora Photosystem Q(B) protein, also known as PSII D1 protein, is a critical component of Photosystem II (PSII) in plants. It is a full-length recombinant protein (1-344 amino acids) expressed in E. coli with an N-terminal His tag for purification and structural studies . This protein is essential for electron transport in the PSII reaction center, where it binds plastoquinone (Q(B)) and participates in oxygen evolution .

Functional Roles

  • Electron transport: Facilitates plastoquinone reduction at the Q(B) site, enabling proton translocation across thylakoid membranes .

  • Herbicide interaction: Q(B) site is a target for herbicides like atrazine and diuron, which block electron flow .

Photoinactivation and D1 Protein Degradation

Under low-light conditions, charge recombination between P680- ⁺ (primary donor) and Q(A)- ⁻ (electron acceptor) generates reactive oxygen species (ROS), including singlet oxygen (¹O₂). These species oxidatively damage the D1 protein, necessitating its replacement via a repair cycle .

Key Mechanism:

  1. Charge recombination: P680- ⁺ + Q(A)- ⁻ → P680 + Q(A)

  2. ROS formation: Interaction with oxygen generates ¹O₂, which damages D1’s C-terminal domain .

Experimental Observations

  • Degradation kinetics: D1 protein degradation lags behind PSII activity loss, indicating pre-existing "tagged" proteins awaiting replacement .

  • Thermodynamic regulation: Acidification of the thylakoid lumen (high ΔpH) modulates Q(A) redox potential, influencing electron flow .

Applications in Research and Biotechnology

ApplicationDetails
PSII repair studiesInvestigating D1 turnover rates and photoprotection mechanisms .
Herbicide developmentScreening inhibitors targeting Q(B) site for agricultural pest control .
Biophysical assaysStructural studies using NMR or X-ray crystallography (aided by His tag) .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery details.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate with us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can serve as a reference for your own preparations.
Shelf Life
The shelf life is influenced by various factors including storage conditions, buffer components, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type in mind, please communicate it to us, and we will prioritize developing the specified tag.
Synonyms
psbA; Photosystem II protein D1; PSII D1 protein; Photosystem II Q(B protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-344
Protein Length
full length protein
Species
Oenothera parviflora (Small-flowered evening primrose) (Oenothera cruciata)
Target Names
psbA
Target Protein Sequence
MTAILERRESESLWGRFCNWITSTENRLYIGWFGVLMIPTLLTATSVFIIAFIAAPPVDI DGIREPVSGSLLYGNNIISGAIIPTSAAIGLHFYPIWEAASVDEWLYNGGPYELIVLHFL LGVACYMGREWELSFRLGMRPWIAVAYSAPVAAATAVFLIYPIGQGSFSDGMPLGISGTF NFMIVFQAEHNILMHPFHMLGVAGVFGGSLFSAMHGSLVTSSLIRETTENESANEGYRFG QEEETYNIVAAHGYFGRLIFQYASFNNSRSLHFFLAAWPVVGIWFTALGISTMAFNLNGF NFNQSVVDSQGRVINTWADIINRANLGMEVMHERNAHNFPLDLA
Uniprot No.

Target Background

Function
Photosystem II (PSII) is a light-driven water:plastoquinone oxidoreductase. It utilizes light energy to extract electrons from H2O, generating O2 and a proton gradient that subsequently powers ATP formation. PSII consists of a core antenna complex responsible for capturing photons and an electron transfer chain that converts photonic excitation into a charge separation. The D1/D2 (PsbA/PsbD) reaction center heterodimer binds P680, the primary electron donor of PSII, along with several downstream electron acceptors.
Protein Families
Reaction center PufL/M/PsbA/D family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the Photosystem Q(B) protein in Oenothera species?

Photosystem Q(B) protein, also known as PsbA or D1 protein, is a critical component of the Photosystem II complex in Oenothera species. This protein is encoded by the chloroplast psbA gene and functions as an integral membrane protein in the thylakoid membrane. The protein serves as the primary binding site for electron acceptors in PSII and is essential for photosynthetic electron transport. In Oenothera species, this protein consists of 344 amino acids and plays a crucial role in photosynthetic processes .

The protein is sometimes referred to by several synonyms in scientific literature:

  • Photosystem II protein D1

  • PSII D1 protein

  • Photosystem II Q(B) protein

What is the genomic context of the psbA gene in Oenothera species?

The psbA gene in Oenothera species is located in the chloroplast genome. Research on Oenothera plastid genomes has revealed five genetically distinct plastid genomes within the subsection Oenothera. These plastomes show remarkable polymorphism that can lead to plastid-nuclear incompatibilities in certain hybrid combinations, a phenomenon known as plastid genome incompatibility (PGI) .

The regulatory regions of photosynthesis genes, including the psbA gene, are particularly important. In Oenothera, the regulation of photosynthesis-related operons, such as the psbB operon, can be affected by polymorphisms in the promoter regions. These variations have been shown to influence transcription in a light-dependent manner in certain genetic backgrounds .

What expression systems are currently used for recombinant Oenothera Photosystem Q(B) protein production?

Escherichia coli is the predominant expression system used for recombinant production of Oenothera Photosystem Q(B) protein. The full-length protein (1-344 amino acids) has been successfully expressed in E. coli with an N-terminal His-tag for purification purposes .

Key considerations for expression include:

  • Vector design with appropriate promoters for membrane protein expression

  • Optimization of codon usage for E. coli

  • Growth conditions that minimize toxicity of the membrane protein to the bacterial host

  • Inclusion of affinity tags (commonly His-tag) to facilitate purification

What are the optimal storage conditions for recombinant Photosystem Q(B) protein?

Based on established protocols for recombinant Oenothera Photosystem Q(B) proteins, the following storage guidelines are recommended:

Storage ParameterRecommended ConditionNotes
Long-term storage-20°C to -80°CAliquoting is necessary to prevent repeated freeze-thaw cycles
Working aliquots4°CStable for up to one week
Storage bufferTris/PBS-based buffer with 6% Trehalose, pH 8.0Provides stability during storage
FormLyophilized powderFor long-term stability
ReconstitutionDeionized sterile water to 0.1-1.0 mg/mLAddition of 5-50% glycerol recommended
Freeze-thaw cyclesMinimizeRepeated freezing and thawing not recommended

How can protein yield and purity be optimized when producing recombinant Photosystem Q(B) protein?

For optimal yield and purity of recombinant Photosystem Q(B) protein from Oenothera species, researchers should consider the following methodological approaches:

  • Expression optimization:

    • Use lower temperatures (16-20°C) during induction to reduce inclusion body formation

    • Optimize induction conditions (IPTG concentration, induction time)

    • Consider specialized E. coli strains designed for membrane protein expression

  • Purification strategy:

    • Implement two-step purification using affinity chromatography followed by size exclusion

    • Use appropriate detergents for membrane protein solubilization

    • Target >90% purity as determined by SDS-PAGE

  • Quality control:

    • Verify protein identity using mass spectrometry

    • Assess protein integrity through circular dichroism

    • Confirm functional activity through binding assays

What methods are most effective for studying the structure of recombinant Photosystem Q(B) protein?

Multiple complementary approaches can be employed to study the structure of recombinant Photosystem Q(B) protein:

  • Spectroscopic methods:

    • Circular dichroism (CD) for secondary structure analysis

    • Fluorescence spectroscopy for tertiary structure information

    • FTIR spectroscopy for membrane protein conformational analysis

  • Advanced structural techniques:

    • X-ray crystallography (challenging for membrane proteins)

    • Cryo-electron microscopy (increasingly popular for membrane protein complexes)

    • NMR spectroscopy (limited by protein size)

  • Computational approaches:

    • Homology modeling based on existing photosystem structures

    • Molecular dynamics simulations to study conformational dynamics

For membrane proteins like Photosystem Q(B), proper solubilization in detergent micelles or reconstitution into lipid nanodiscs is crucial for maintaining native-like structure during analysis.

How can the functional activity of recombinant Photosystem Q(B) protein be assessed?

Functional assessment of recombinant Photosystem Q(B) protein can be performed using the following methodological approaches:

  • Electron transport assays:

    • Artificial electron acceptor/donor systems

    • Oxygen evolution measurements

    • Chlorophyll fluorescence analysis

  • Binding studies:

    • Herbicide binding (many herbicides target the QB binding site)

    • Isothermal titration calorimetry for binding thermodynamics

    • Surface plasmon resonance for binding kinetics

  • Reconstitution studies:

    • Incorporation into liposomes or nanodiscs

    • Assembly with other PSII components

    • Light-induced electron transfer measurements

The challenge lies in replicating the native membrane environment and proper assembly with other photosystem components for functional studies.

How do mutations in the psbA gene affect photosynthetic performance in Oenothera species?

Mutations in the psbA gene can significantly impact photosynthetic performance in Oenothera species. Research on Oenothera plastid genomes has revealed that sequence variations in photosynthesis-related genes can lead to altered regulatory patterns and protein function .

In particular:

  • Promoter region mutations can affect transcription efficiency in a light-dependent manner

  • Coding sequence mutations may alter protein structure or function

  • Some mutations may contribute to plastid-nuclear incompatibilities observed in certain Oenothera hybrids

A study on Oenothera plastid genomes demonstrated that a deletion affecting the psbB operon (which includes photosynthesis-related genes) resulted in altered gene expression patterns in incompatible hybrids under high light conditions . Although this specific example involves the psbB operon rather than psbA directly, it illustrates how genetic variations in photosynthesis-related genes can impact photosynthetic performance in Oenothera species.

What insights can be gained from studying Photosystem Q(B) proteins across different Oenothera species?

Comparative analysis of Photosystem Q(B) proteins across Oenothera species offers valuable insights into:

  • Evolutionary conservation:

    • The identical amino acid sequences observed between O. glazioviana and O. argillicola suggest strong evolutionary constraints on this protein

    • Conservation patterns may reveal functionally critical domains

  • Species adaptation:

    • Subtle variations in sequence or regulation may reflect adaptation to different environmental niches

    • O. parviflora, for example, grows in sandy or gravelly soil in sun-exposed habitats , which may impose specific selective pressures on photosynthetic machinery

  • Plastid-nuclear compatibility mechanisms:

    • Oenothera species exhibit interesting plastid-nuclear interactions

    • Understanding how photosystem components contribute to these compatibility mechanisms provides insights into organellar evolution

How can recombinant Oenothera Photosystem Q(B) protein be used to study photoinhibition mechanisms?

Recombinant Photosystem Q(B) protein offers a valuable tool for investigating photoinhibition mechanisms through several experimental approaches:

  • Site-directed mutagenesis studies:

    • Introduction of specific amino acid changes to assess their impact on photodamage susceptibility

    • Creation of variants mimicking naturally occurring mutations

    • Analysis of residues involved in binding of photosynthetic inhibitors

  • Reconstitution experiments:

    • In vitro assembly with other PSII components

    • Controlled exposure to high light conditions

    • Measurement of photodamage rates and repair mechanisms

  • Interaction studies:

    • Identification of proteins involved in D1 turnover and repair

    • Analysis of post-translational modifications under stress conditions

    • Investigation of protective mechanisms against photodamage

These approaches can provide insights into how different Oenothera species have adapted their photosynthetic machinery to their specific environmental niches.

What role does Photosystem Q(B) protein play in plastid genome incompatibility in Oenothera?

Plastid genome incompatibility (PGI) is a widespread phenomenon in Oenothera, and components of the photosynthetic machinery may play important roles in these incompatibilities. Research suggests that:

  • Sequence variations in plastid-encoded genes, including photosynthesis-related genes, can lead to incompatibilities in certain nuclear backgrounds

  • Polymorphisms affecting gene regulation can result in altered expression patterns in hybrid combinations. For example, a deletion near the promoter region of the psbB operon affects its regulation in a light-dependent manner in incompatible hybrids

  • The antisense interaction between the psbB operon and pbf1 (photosystem biogenesis factor 1) transcripts provides an example of how complex regulatory interactions in photosynthetic gene expression can contribute to compatibility issues

While the specific role of Photosystem Q(B) protein/psbA in plastid genome incompatibility is not directly addressed in the provided information, its central role in photosynthesis suggests it could be involved in similar regulatory networks affecting plastid-nuclear compatibility.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.