Recombinant Oligopeptide transport system permease protein AmiC (amiC)

Shipped with Ice Packs
In Stock

Description

Oligopeptide Transport

As part of the Ami permease system, AmiC collaborates with:

  • Transmembrane partner AmiD

  • ATPases AmiE and AmiF

  • Oligopeptide-binding lipoproteins (e.g., AmiA, AliA)
    This complex enables selective uptake of oligopeptides (4–8 residues) to overcome bacterial auxotrophies .

Cell Wall Remodeling

AmiC exhibits N-acetylmuramyl-L-alanine amidase activity critical for:

  • Daughter cell separation via septal peptidoglycan cleavage

  • Stationary-phase autolysis regulation

  • Peptidoglycan fragment release influencing host immune responses

Activation Mechanisms

ActivatorEffect on AmiCOrganism TestedReference
NlpDRelieves auto-inhibitionNeisseria meningitidis
ActSEnhances amidase activity 3-foldGram-negative bacteria

Mutant Phenotypes

  • ΔamiC strains:

    • 39% reduced viability in Neisseria gonorrhoeae

    • 10-fold CFU reduction during log-phase growth

    • Hyperaggregation due to failed cell separation

Recombinant Applications

Commercial and experimental uses include:

ApplicationDetailsSource
Protein interaction studiesPurified His-tagged AmiC-CTD (residues 199–432)
Genetic complementationpKH37 vector constructs restoring wild-type phenotypes
Biochemical assaysFITC-PG digestion assays measuring amidase kinetics

Pathogenic Implications

AmiC contributes to virulence through:

  1. Nutritional competitiveness: Peptide scavenging in nutrient-poor host environments

  2. Immune evasion: Controlled peptidoglycan fragment release modulates NOD1 responses

  3. Biofilm formation: Cell aggregation phenotypes in mutants alter colonization dynamics

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its inclusion.
Synonyms
amiC; SP_1890; Oligopeptide transport system permease protein AmiC
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-498
Protein Length
full length protein
Species
Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
Target Names
amiC
Target Protein Sequence
MKKYIFMRVLRSLVSIFLVTTLTYTIIYTLVPRKLIFKQDPNYNKIATTADKRDNYENTV FERMGYIEYYDTKELQEKASSMDSSVTVEANATNKAIYEKYINQLGHGWTLGEFTESGQF YATREIPIFERVFHFYANLIDIDHTNKIQDPENPDLKRYLRFENDPAIGWSLVGSGTKHK YLLYFNSQFPFVHQNFVNLNLGDSYPTYANTPVLQVITQGQGQTKTAQVQFPTGKKTSSV NIYSRTYKSPSQADSREVASYGKDDPYTATESNYQYPSMIVSSAITGLIGLVLAYALAVP LGSAMARFKNTWIDSLSTGALTFLLALPTIALVYIVRLIGSSIALPDSFPILGAGDWRSY VLPAVILGLLGAPGTAIWIRRYMIDLQSQDFVRFARAKGLSEKEISNKHIFKNAMVPLVS GIPAAIIGVIGGATLTETVFAFPGMGKMLIDSVKASNNSMVVGLVFIFTCISIFSRLLGD IWMTIIDPRIKLTEKGGK
Uniprot No.

Target Background

Function
AmiC is a component of the binding-protein-dependent transport system for oligopeptides. Its primary function is likely the translocation of the substrate across the membrane.
Database Links

KEGG: spn:SP_1890

Protein Families
Binding-protein-dependent transport system permease family, OppBC subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the primary function of AmiC in bacterial systems?

AmiC functions as both a transport protein and regulatory element in bacteria. In Mycobacterium smegmatis, AmiC acts as a positive regulatory protein that interacts with AmiA through protein-protein interactions, controlling acetamidase expression . This regulatory mechanism is critical for bacteria that utilize amide compounds as carbon and nitrogen sources. AmiC contains a periplasmic binding domain in its structure, classifying it as a small molecule binding protein that facilitates transport of specific molecules across bacterial membranes . The dual functionality of AmiC in transport and regulation makes it particularly interesting for researchers studying bacterial metabolism and gene regulation.

How does AmiC interact with other proteins in the acetamidase operon regulatory system?

AmiC directly interacts with the negative regulator AmiA and prevents AmiA from binding to the P2 promoter of the acetamidase operon . This interaction represents a classic example of antagonistic protein regulation, where one protein (AmiC) counteracts the activity of another (AmiA). Gel mobility shift assays have demonstrated that AmiC protein inhibits AmiA from binding to the P2 promoter region . Additionally, AmiC binds to the P3 and P1 regulatory regions, thereby controlling AmiA expression itself. This complex interplay creates a regulatory network that finely tunes acetamidase expression in response to environmental conditions. Understanding these interactions provides insights into bacterial adaptation mechanisms and metabolic regulation.

What is the role of AmiC in oligopeptide transport systems?

In bacteria like Streptococcus pneumoniae, AmiC functions as a critical permease subunit of the Ami-AliA/AliB oligopeptide permease system . This transport system facilitates the uptake of small peptides from the extracellular environment into the bacterial cytoplasm. The importance of AmiC in this transport function has been confirmed through deletion studies - when AmiC is disrupted (Δ amiC mutant), the uptake of specific peptides such as V11A is greatly reduced . The transport mechanism likely involves conformational changes in AmiC that allow peptides to move across the cell membrane, a process that requires energy and coordination with other components of the transport system. This peptide acquisition pathway is essential for bacterial nutrition and can influence various cellular processes.

How does AmiC contribute to bacterial recognition of exogenous peptides?

AmiC plays a critical role in bacterial sensing and response to external peptides. In Streptococcus pneumoniae, the Ami-AliA/AliB oligopeptide permease system, which includes AmiC, is responsible for the uptake of specific peptides, including those from other bacterial species . For instance, the peptide V11A derived from Klebsiella pneumoniae is transported into S. pneumoniae via this system. Epifluorescence microscopy using FITC-labeled peptide V11A revealed clear homogeneous intracellular staining in wild-type S. pneumoniae D39 with a functional permease, while showing greatly reduced uptake in the Δ amiC mutant . This demonstrates that AmiC is essential for the recognition and internalization of specific exogenous peptides, which can have significant effects on bacterial physiology and interspecies interactions in microbial communities.

What molecular mechanisms govern AmiC-mediated gene regulation?

AmiC exhibits sophisticated molecular mechanisms for gene regulation. Research has established AmiC as a specific amide binding protein that interacts with inducer molecules such as acetamide . This ligand binding capability allows AmiC to modulate gene regulation through several distinct mechanisms:

  • Direct inhibition of AmiA binding to the P2 promoter through protein-protein interaction

  • Binding to the P3 and P1 regulatory regions to control AmiA expression

  • Interaction with inducer molecules (acetamide) to modulate its regulatory functions

The binding of acetamide to AmiC likely induces conformational changes that affect its interaction with AmiA and/or DNA regulatory elements. This multi-level regulatory system allows for precise control of acetamidase expression in response to environmental conditions. The complexity of this regulatory network represents an elegant example of bacterial adaptation mechanisms.

How does the disruption of AmiC affect bacterial growth and response to environmental peptides?

The functional significance of AmiC becomes evident when examining growth phenotypes in deletion mutants. In S. pneumoniae, the peptide V11A from K. pneumoniae has been shown to inhibit pneumococcal growth, but this inhibitory effect is completely lost in the Δ amiC mutant . This observation indicates that AmiC-mediated peptide uptake can directly influence bacterial growth regulation.

StrainTreatmentPeptide UptakeGrowth Inhibition
S. pneumoniae D39 (wild-type)FITC-V11AClear homogeneous intracellular stainingPresent
S. pneumoniae Δ amiC mutantFITC-V11AGreatly reduced uptakeAbsent

These findings suggest that AmiC not only participates in peptide transport but also mediates signaling pathways that affect growth regulation. The mechanism may involve peptide-induced changes in metabolic pathways, gene expression patterns, or cell division processes. This dual role in transport and signaling makes AmiC an intriguing target for studies on bacterial communication and community interactions.

What are the optimal expression systems for producing recombinant AmiC protein?

Successful production of recombinant AmiC requires careful consideration of expression systems. Based on research practices with similar periplasmic binding proteins, the following approaches are recommended:

  • Bacterial Expression Systems: E. coli BL21(DE3) strains with pET-based vectors have proven effective for expressing recombinant periplasmic binding proteins with appropriate solubility and folding . The addition of a polyhistidine tag facilitates purification without significantly affecting protein function.

  • Expression Optimization Parameters:

    • Induction at lower temperatures (16-25°C) often improves proper folding

    • IPTG concentration optimization (typically 0.1-1.0 mM)

    • Inclusion of specific chaperones to assist proper folding

    • Growth in minimal media with specific carbon sources to avoid catabolite repression

  • Purification Strategy: A multi-step purification approach including immobilized metal affinity chromatography followed by size exclusion chromatography yields the highest purity recombinant AmiC suitable for functional and structural studies.

The choice of expression system should be guided by the intended application of the recombinant protein, whether for structural studies, binding assays, or functional characterization.

What techniques can effectively characterize AmiC-peptide interactions?

Characterizing AmiC-peptide interactions requires a combination of biophysical and functional approaches:

  • Fluorescence-Based Assays: The use of FITC-labeled peptides combined with epifluorescence microscopy has successfully demonstrated AmiC-dependent peptide uptake in bacterial cells . This approach can be adapted to:

    • Compare uptake efficiency between wild-type and mutant strains

    • Examine competition between different peptides

    • Investigate uptake kinetics under various conditions

  • Binding Affinity Determination:

    • Isothermal Titration Calorimetry (ITC) to measure thermodynamic parameters

    • Surface Plasmon Resonance (SPR) for real-time binding kinetics

    • Microscale Thermophoresis for binding in complex solutions

  • Structural Approaches:

    • X-ray crystallography of AmiC-peptide complexes

    • Cryo-electron microscopy to visualize conformational changes

    • Hydrogen-deuterium exchange mass spectrometry to identify binding interfaces

These complementary approaches provide a comprehensive understanding of the specificity, affinity, and structural basis of AmiC-peptide interactions.

How can researchers effectively study the regulatory network involving AmiC?

Investigating the complex regulatory network involving AmiC requires integrative approaches:

  • Gel Mobility Shift Assays: This technique has been successfully employed to demonstrate that AmiC protein inhibits AmiA from binding to the P2 promoter . The experimental design involves:

    • Purification of recombinant AmiC and AmiA proteins

    • Preparation of labeled DNA fragments containing promoter regions

    • Incubation of proteins with DNA in various combinations

    • Electrophoretic separation to observe binding patterns

  • Chromatin Immunoprecipitation (ChIP):

    • Identification of in vivo binding sites for AmiC in the bacterial genome

    • Analysis of temporal changes in binding patterns under various conditions

    • Integration with transcriptomic data to correlate binding with gene expression

  • Transcriptomic Analysis:

    • RNA-sequencing to identify genes regulated by AmiC

    • Differential expression analysis between wild-type and ΔamiC mutants

    • Time-course studies following induction with various substrates

The integration of these approaches allows researchers to construct a comprehensive model of the AmiC regulatory network and its dynamic responses to environmental conditions.

How can AmiC research contribute to understanding bacterial communication in microbial communities?

The discovery that AmiC mediates the uptake of peptides from other bacterial species (like V11A from K. pneumoniae) opens exciting avenues for research on interspecies communication . Future research directions include:

  • Metagenomic Analysis: Identifying naturally occurring peptides in microbial communities that may interact with AmiC and influence bacterial behavior.

  • Synthetic Biology Approaches: Engineering peptide signals specifically recognized by AmiC to modulate bacterial behavior in mixed populations.

  • Ecological Studies: Investigating how AmiC-mediated peptide sensing influences community dynamics, succession patterns, and bacterial adaptation in complex microbiomes.

These approaches can reveal how bacteria use oligopeptide transporters like AmiC to sense and respond to their social environment, potentially leading to new strategies for manipulating bacterial communities in various contexts.

What is the potential of AmiC as a target for antimicrobial development?

The essential role of AmiC in peptide transport and growth regulation makes it a promising target for antimicrobial development:

  • Inhibitor Design: Structure-based design of small molecules that block the peptide binding site of AmiC, preventing essential nutrient uptake.

  • Trojan Horse Approach: Development of antimicrobial peptides that are recognized by AmiC and transported into bacterial cells, but have toxic effects once internalized.

  • Resistance Considerations: Analysis of potential resistance mechanisms to AmiC-targeted antimicrobials and strategies to overcome them.

The specificity of the Ami-AliA/AliB system in certain pathogens may allow for targeted antimicrobial approaches with reduced effects on beneficial microbiota compared to broad-spectrum antibiotics.

How do environmental conditions influence AmiC expression and function?

Understanding the environmental regulation of AmiC is crucial for comprehensive functional characterization:

  • Nutrient Availability: Investigation of how carbon and nitrogen source availability influences AmiC expression and activity, particularly in relation to acetamide and related compounds .

  • Stress Responses: Analysis of AmiC expression and function under various stress conditions, including:

    • Nutrient limitation

    • pH stress

    • Oxidative stress

    • Competitive interactions with other microorganisms

  • Host-Pathogen Interactions: For pathogenic bacteria, examination of how host environments influence AmiC expression and contribute to virulence or persistence.

These studies will provide insights into the ecological and physiological contexts in which AmiC functions and how bacteria adapt their peptide transport and regulatory systems to diverse environments.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.