Recombinant Oligotropha carboxidovorans ATP synthase subunit a (atpB)

Shipped with Ice Packs
In Stock

Description

Overview of ATP Synthase Subunit a (atpB)

ATP synthase is a membrane-bound enzyme complex responsible for ATP synthesis during oxidative phosphorylation. Subunit a (encoded by the atpB gene) is a core component of the F₀ sector, which facilitates proton translocation across the membrane. In O. carboxidovorans, this subunit is essential for chemolithoautotrophic growth under energy-limiting conditions .

Characteristics of Recombinant atpB

The recombinant variant retains the functional and structural properties of the native protein, as evidenced by its production and purification protocols :

PropertyDetails
UniProt IDB6JDD0
Gene LocusOCAR_4700, OCA5_c32500 (chromosomal)
Expression SystemRecombinant protein produced in E. coli (exact strain unspecified)
Amino Acid SequenceMADPVEQFEIHKIFSLGHIGGQEIAFTNSSLY... (249 residues, full-length sequence)
Storage ConditionsTris-based buffer with 50% glycerol; stable at -20°C or -80°C

Functional Role in O. carboxidovorans

  • Energy Coupling: AtpB forms part of the proton channel in the F₀ sector, enabling ATP synthesis via the proton gradient generated during CO or H₂ oxidation .

  • Metabolic Adaptation: Proteomic studies show ATP synthase subunits are upregulated during chemolithoautotrophic growth, linking atpB to syngas (CO/H₂/CO₂) utilization .

  • Structural Stability: The recombinant protein retains redox-active residues critical for proton translocation, as inferred from sequence conservation with homologs in related species .

Research Applications

Recombinant atpB is utilized in:

  • Enzyme Kinetics: Studying proton translocation efficiency under varying pH or ion concentrations.

  • Structural Biology: Crystallization trials to resolve conformational changes during ATP synthesis .

  • Biotechnological Engineering: Metabolic engineering of O. carboxidovorans for enhanced syngas fermentation .

Technical Notes for Experimental Use

  • Avoid Repeated Freeze-Thaw: Aliquots stored at 4°C retain activity for ≤1 week .

  • Detection Methods: ELISA-compatible due to epitope tags introduced during recombinant production .

Future Directions

  • Mechanistic Studies: Resolve the role of conserved residues (e.g., Arg-176, Glu-198) in proton channel gating.

  • Industrial Relevance: Optimize recombinant expression for large-scale applications in biofuel production .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we understand the importance of specific requirements. If you have any particular preferences regarding the format, please indicate them in your order notes, and we will make every effort to fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. We recommend contacting your local distributors for specific delivery timelines.
Note: All protein shipments are standardly packaged with blue ice packs. If dry ice is preferred, please inform us in advance, as additional charges may apply.
Notes
Repeated freezing and thawing is not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
To ensure proper reconstitution, we recommend briefly centrifuging the vial before opening to settle the contents. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We advise adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50% and can serve as a reference point.
Shelf Life
The shelf life of our products is influenced by several factors, including storage conditions, buffer components, temperature, and the inherent stability of the protein itself.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple use to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing your specified tag.
Synonyms
atpB; OCAR_4700; OCA5_c32500; ATP synthase subunit a; ATP synthase F0 sector subunit a; F-ATPase subunit 6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-249
Protein Length
full length protein
Species
Oligotropha carboxidovorans (strain ATCC 49405 / DSM 1227 / KCTC 32145 / OM5)
Target Names
atpB
Target Protein Sequence
MADPVEQFEIHKIFSLGHIGGQEIAFTNSSLYMLLAVGAVALLMLGGSAGRRLVPTRFQS MAELSYEFVVNMVRESLGEEGMKFFPLVFSIFMFVLMANLIGVIPYTFSVTSHLIVTVAL ALIVFLTVLLYGLYKNGLKFFRVFVPSGVPIYILPLIAMIEVISFLSRPVSHSVRLFANM LAGHITLKVFASFVTSLGALGVAGIAGAALPLAMTTAISILEVLVALLQAYVFAILTCIY LNDALHPGH
Uniprot No.

Target Background

Function
As a key component of the proton channel, it plays a direct role in the translocation of protons across the membrane.
Database Links
Protein Families
ATPase A chain family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the role of subunit a (atpB) in Oligotropha carboxidovorans ATP synthase?

Subunit a (atpB) in O. carboxidovorans is a critical component of the ATP synthase Fo domain located in the cell membrane. This subunit forms part of the proton channel that converts the proton electrochemical gradient into mechanical energy for ATP synthesis. The subunit is integral to the membrane portion of ATP synthase and works in conjunction with the c-ring rotor to facilitate proton translocation across the membrane. Similar to mitochondrial ATP synthase subunit a, the bacterial atpB contributes to the formation of the proton pathway and is essential for energy transduction during both ATP synthesis and hydrolysis .

How does O. carboxidovorans ATP synthase function differ between autotrophic and heterotrophic growth conditions?

O. carboxidovorans can grow under both chemolithoautotrophic conditions (using CO and H₂ to fix CO₂) and heterotrophic conditions (using organic carbon sources like acetate). Proteomic analyses reveal significant adaptations in energy metabolism between these growth conditions. Under autotrophic conditions, proteins involved in CO₂ fixation via the Calvin-Benson-Bassham cycle, CO metabolism (CO dehydrogenase), and H₂ utilization (hydrogenase) show higher expression . These changes impact ATP synthase activity, as the enzyme must adjust to different energetic inputs. Additionally, membrane fatty acid composition changes between growth conditions, likely affecting the lipid environment of membrane-embedded ATP synthase complexes .

Why is recombinant expression of O. carboxidovorans atpB of interest for researchers?

Recombinant expression of O. carboxidovorans atpB enables detailed structure-function studies that would be difficult using native protein sources. Since O. carboxidovorans can utilize synthesis gas (CO, CO₂, H₂) for growth, its ATP synthase has evolved to function efficiently under these unique metabolic conditions. Researchers are interested in the specific adaptations of this ATP synthase subunit that allow it to perform in a bacterium capable of using C1-containing gases. The recombinant approach allows for site-directed mutagenesis, fusion with reporter tags for localization studies, and higher protein yields for structural analysis .

What expression systems are most suitable for recombinant O. carboxidovorans atpB?

For recombinant expression of O. carboxidovorans atpB, multiple expression systems can be considered with distinct advantages and limitations:

Expression SystemAdvantagesLimitationsConsiderations
E. coliHigh yield, rapid growth, established protocolsMay form inclusion bodiesOptimizing codons, using specialized strains (C41/C43) for membrane proteins
Homologous expression in O. carboxidovoransNative folding environmentLower yields, more complex culturingUtilization of recently established electroporation protocols
Cell-free systemsAvoids toxicity issues, direct access to reaction environmentHigher cost, potentially lower yieldSuitable for functional studies requiring rapid iteration

For most structural and biochemical studies, E. coli remains the preferred heterologous system, as demonstrated by successful expression of bacterial ATP synthase components from other species . The recent development of transformation protocols for O. carboxidovorans via electroporation opens possibilities for homologous expression, which might better preserve native characteristics of the subunit .

What are the challenges in purifying functional recombinant atpB, and how can they be addressed?

Purification of functional recombinant atpB presents several challenges due to its highly hydrophobic nature and integral membrane position. Methodology to overcome these challenges includes:

  • Membrane protein solubilization: Careful selection of detergents is crucial. Mild detergents like n-dodecyl β-D-maltoside (DDM) or digitonin are often preferred to maintain protein structure while extracting from the membrane.

  • Stability during purification: The isolated subunit a tends to be unstable when separated from other ATP synthase components. Co-expression with other subunits, particularly those it directly interacts with in the Fo sector, can enhance stability.

  • Functionality assessment: Since subunit a is not enzymatically active in isolation, functional reconstitution into proteoliposomes or nanodiscs may be necessary to verify proper folding and proton translocation capability.

  • Contamination with host ATP synthase components: Affinity tags placed at carefully selected positions that don't interfere with function, combined with stringent washing steps, can minimize co-purification of host components .

How does the structure of O. carboxidovorans atpB compare to characterized ATP synthase subunit a from other organisms?

While no high-resolution structure specifically of O. carboxidovorans atpB has been published in the search results, comparative analysis with other bacterial ATP synthases provides valuable insights. Bacterial ATP synthase subunit a typically contains 5-6 transmembrane helices that form part of the proton channel. The structural architecture allows for:

  • Formation of a half-channel for proton entry from the periplasmic (or extracellular) side

  • A critical arginine residue that mediates proton transfer to/from the c-ring

  • A second half-channel for proton exit to the cytoplasmic side

Key structural differences may exist in O. carboxidovorans atpB compared to other bacterial homologs, particularly in regions that interact with the surrounding lipid environment. This is suggested by the noted changes in membrane fatty acid composition when O. carboxidovorans shifts between heterotrophic and autotrophic growth modes .

What spectroscopic methods are most informative for studying recombinant O. carboxidovorans atpB?

Several spectroscopic approaches can provide valuable insights into the structure and dynamics of recombinant O. carboxidovorans atpB:

MethodInformation ObtainedSample RequirementsSpecial Considerations
Cryo-electron microscopy (Cryo-EM)High-resolution structural information, rotational statesPurified protein (preferably full complex)May require expression of complete ATP synthase for stable structure
Circular dichroism (CD)Secondary structure composition, thermal stabilityRelatively pure protein preparationLess affected by protein size, good for confirming proper folding
Fourier-transform infrared spectroscopy (FTIR)Protonation states of key residuesCan work with reconstituted systemsUseful for probing proton translocation mechanism
Site-directed spin labeling with EPRLocal structural dynamicsRequires cysteine mutantsCan probe conformational changes during function

Cryo-EM has proven particularly valuable for bacterial ATP synthases, allowing visualization of different rotational states and providing insights into the mechanism of proton translocation through the Fo domain, including subunit a .

How can researchers evaluate the functional integrity of recombinant O. carboxidovorans atpB?

Assessing the functional integrity of recombinant atpB requires specialized approaches since the isolated subunit lacks catalytic activity. Recommended methods include:

  • Reconstitution assays: Incorporating purified atpB along with other Fo components into liposomes, followed by measuring proton pumping activity or ATP synthesis when combined with F1.

  • Complementation studies: Expressing O. carboxidovorans atpB in ATP synthase-deficient bacterial strains to assess restoration of growth on non-fermentable carbon sources.

  • Proton translocation measurements: Using pH-sensitive fluorescent dyes to monitor proton movement across membranes containing reconstituted Fo complexes with the recombinant atpB.

  • Binding studies with other ATP synthase components: Measuring interactions between atpB and other subunits (particularly c-ring) to verify correct assembly potential.

These approaches can distinguish between properly folded, functional protein and misfolded variants, providing critical quality control for downstream structural or mechanistic studies .

How can site-directed mutagenesis of O. carboxidovorans atpB inform our understanding of proton translocation?

Site-directed mutagenesis of key residues in O. carboxidovorans atpB offers powerful insights into the mechanism of proton translocation. Based on structural and functional studies of ATP synthases, several targets for mutagenesis warrant investigation:

  • The conserved arginine residue: This residue likely functions at the interface between subunit a and the c-ring, facilitating proton transfer. Mutations altering charge, size, or hydrogen-bonding capability can reveal its precise role.

  • Residues lining the half-channels: Identifying and mutating residues that form the proton pathways can map the exact route of proton movement through the Fo domain.

  • Interface residues with the c-ring: Mutations at the a/c interface can reveal how these subunits interact during rotation and how this interaction contributes to the tight coupling between proton movement and mechanical rotation.

  • Residues involved in oligomerization: As ATP synthases often form dimers and higher oligomers, mutations affecting potential oligomerization interfaces can elucidate the functional significance of these supramolecular arrangements in O. carboxidovorans .

The recently established protocols for genetic manipulation of O. carboxidovorans make these approaches increasingly feasible in the native organism context .

What insights can comparative studies between autotrophic and heterotrophic conditions provide regarding atpB function?

Comparative studies of O. carboxidovorans grown under autotrophic versus heterotrophic conditions reveal significant adaptations that likely impact atpB function:

  • Membrane composition changes: FAME analysis shows altered fatty acid profiles between autotrophic and heterotrophic growth. These changes modify the lipid environment surrounding ATP synthase, potentially affecting proton permeability, enzyme stability, and rotational dynamics .

  • Energy coupling mechanisms: Under autotrophic conditions, energy is derived from CO and H₂ oxidation, whereas heterotrophic growth utilizes acetate metabolism. This difference in energy source affects the magnitude and potentially the stability of the proton motive force driving ATP synthase.

  • Regulatory adaptations: Proteomic analyses indicate changes in oxidative homeostasis proteins between growth conditions, suggesting differences in the redox environment that may influence ATP synthase activity and regulation .

  • Protein expression levels: The differential expression of ATP synthase components between growth conditions may reflect adaptations to varying ATP demands or proton motive force characteristics under different metabolic modes .

These comparative studies can reveal how O. carboxidovorans atpB and the whole ATP synthase complex adapt to the energetic challenges of utilizing different carbon and energy sources.

How might O. carboxidovorans atpB be engineered for enhanced activity or stability?

Engineering enhanced activity or stability in O. carboxidovorans atpB could pursue several promising strategies:

  • Rational design based on structural insights: Using structural models of ATP synthase to identify residues that might limit stability or activity, followed by targeted mutations to improve these properties.

  • Directed evolution approaches: Now feasible with the established transformation protocols for O. carboxidovorans, allowing selection for variants with improved characteristics under specific conditions .

  • Chimeric constructs: Creating fusion proteins incorporating stable elements from homologous subunits from extremophiles to enhance thermal or pH stability.

  • Post-translational modifications: Identifying and potentially engineering specific sites for modifications that might enhance stability in different environments.

  • Lipid interaction optimization: Engineering the hydrophobic surfaces that interact with membrane lipids to function optimally in the desired expression system or application context, informed by the known membrane adaptations observed in different growth conditions .

Success in these engineering efforts would benefit from the recent advances in genetic manipulation techniques for O. carboxidovorans, including the established electroporation protocols and gene deletion/exchange methods .

How does O. carboxidovorans atpB interact with other Fo subunits in the ATP synthase complex?

The interaction of O. carboxidovorans atpB with other Fo subunits is central to ATP synthase function. While specific studies on O. carboxidovorans ATP synthase assembly are not detailed in the search results, comparative analysis with other bacterial ATP synthases suggests:

  • Interface with subunit c: Subunit a forms a crucial interface with the c-ring rotor, creating the pathway for protons to access the critical glutamate residue on each c subunit. This interaction must permit rotation while maintaining a seal to prevent proton leakage.

  • Connection to the peripheral stalk: In bacterial ATP synthases, subunit a likely interacts with components of the peripheral stalk (similar to subunits b and δ in E. coli nomenclature), helping to anchor the stator complex.

  • Association with subunit A6L homolog: By analogy with mitochondrial ATP synthase, subunit a likely forms important contacts with the bacterial homolog of A6L (ATP8), which provides a physical link between the proton channel and other subunits of the peripheral stalk .

  • Role in dimerization: Subunit a may participate in ATP synthase dimerization, as observed in mitochondrial systems, where it forms the basis for higher-order organization of ATP synthase in the membrane .

These interactions collectively establish the functional architecture of the ATP synthase complex, ensuring efficient coupling between proton translocation and ATP synthesis.

What are the key considerations when co-expressing atpB with other ATP synthase subunits?

Co-expression of atpB with other ATP synthase subunits presents several important considerations:

  • Expression balance: Maintaining appropriate stoichiometry between subunits is critical. Strategies may include using polycistronic constructs, tunable promoters, or separate plasmids with compatible origins and carefully selected promoter strengths.

  • Assembly sequence: Considering the natural assembly pathway of ATP synthase can inform co-expression strategies. In bacterial systems, evidence suggests that the c-ring assembles first, followed by F₁ attachment, then incorporation of the stator arm, and finally subunits a and A6L equivalents .

  • Membrane insertion capacity: Expression systems have limited capacity for membrane protein insertion. Overexpression of multiple membrane proteins may saturate the Sec or YidC translocation machinery, necessitating careful optimization of induction conditions.

  • Selection of fusion tags: When tagging multiple subunits, placement and type of tags should minimize interference with complex assembly. Compatibility of purification strategies for differently tagged subunits must be considered.

  • Verification of complex formation: Techniques such as blue native PAGE or clear native PAGE can verify successful assembly of co-expressed subunits into higher-order complexes .

Recent success with heterologous expression of bacterial ATP synthases suggests these challenges can be overcome with careful optimization .

How do oligomeric states of ATP synthase affect the function of O. carboxidovorans atpB?

The oligomeric organization of ATP synthase complexes significantly impacts the function of subunit a, with implications for O. carboxidovorans atpB:

  • Dimer formation stability: Dimerization provides structural stability to ATP synthase, which is continuously subject to dynamic rotor/stator interactions. Subunit a is proposed to form the most important basis for dimerization due to its multiple transmembrane helices .

  • Membrane curvature effects: ATP synthase dimers contribute to the curvature of the bacterial membrane. This architectural role may be particularly important in O. carboxidovorans as it adapts to different growth conditions with altered membrane compositions .

  • Enhanced ATP synthesis: Oligomerization facilitates ATP synthesis by creating local membrane protrusions that function as proton traps, increasing local proton concentration. This arrangement may be especially advantageous for O. carboxidovorans during autotrophic growth when energy resources are more limited .

  • Altered proton access: The organization of dimers and oligomers can create specialized microenvironments that affect proton access to the entry half-channel of subunit a, potentially optimizing proton capture under different energetic conditions.

Research examining how oligomeric states differ between autotrophic and heterotrophic growth conditions could provide valuable insights into the adaptive function of O. carboxidovorans ATP synthase .

What novel approaches can be used to study the in vivo dynamics of O. carboxidovorans atpB?

Advanced methodologies for studying in vivo dynamics of O. carboxidovorans atpB include:

  • Fluorescence resonance energy transfer (FRET): By tagging atpB and interacting proteins with appropriate fluorophores, conformational changes and protein-protein interactions can be monitored in living cells.

  • Single-molecule tracking: Using photoactivatable fluorescent proteins fused to atpB allows tracking of individual molecules, providing insights into diffusion, clustering, and turnover rates in different membrane regions.

  • Super-resolution microscopy: Techniques like PALM, STORM, or STED can overcome the diffraction limit, allowing visualization of atpB distribution and organization at nanometer resolution.

  • Genetic reporters: Constructing fusions between atpB and split reporters (like split GFP or luciferase) can reveal assembly dynamics and interactions with other subunits.

  • Inducible expression systems: The recently developed genetic tools for O. carboxidovorans enable creation of inducible systems to study atpB expression and incorporation into ATP synthase complexes under controlled conditions .

These approaches can reveal how atpB behaves in the context of living cells, particularly during transitions between heterotrophic and autotrophic growth conditions.

How can cryo-electron microscopy be optimized for studying O. carboxidovorans ATP synthase structure?

Optimization of cryo-EM for studying O. carboxidovorans ATP synthase involves several critical considerations:

  • Sample preparation strategies:

    • Detergent selection is crucial for extracting intact ATP synthase complexes while maintaining native structure

    • Amphipol or nanodisc reconstitution can provide a more native-like environment than detergent micelles

    • GraFix method (gradient fixation) can stabilize complexes during preparation

  • Image acquisition parameters:

    • Collection of tilt series to address preferred orientation issues common with membrane proteins

    • Energy filters to enhance contrast of the relatively small (~600 kDa) ATP synthase complex

    • Phase plates to improve contrast, especially for visualizing the membrane domain containing atpB

  • Computational approaches:

    • Classification strategies to separate different rotational states, as demonstrated with other bacterial ATP synthases

    • Focused refinement on the Fo region to enhance resolution of atpB and interacting subunits

    • Particle subtraction techniques to better resolve the membrane-embedded portions

  • Comparative analysis:

    • Imaging ATP synthase from cells grown under both heterotrophic and autotrophic conditions to identify structural adaptations

These optimizations can help achieve high-resolution structures of O. carboxidovorans ATP synthase in different functional states, providing insights into how atpB contributes to energy conversion.

What computational methods are valuable for predicting atpB structure-function relationships?

Computational methods offer powerful approaches to predict structure-function relationships in O. carboxidovorans atpB:

  • Homology modeling: Using resolved structures of bacterial ATP synthases as templates to predict the structure of O. carboxidovorans atpB, with particular attention to the transmembrane helices and residues lining the proton pathway .

  • Molecular dynamics simulations: Simulating atpB in a lipid bilayer environment to understand:

    • Proton movement through the half-channels

    • Conformational changes during interaction with rotating c-subunits

    • Effects of membrane composition changes observed between growth conditions

  • Coevolution analysis: Methods like Direct Coupling Analysis (DCA) can identify residue pairs that have co-evolved, revealing functionally important interactions both within atpB and between atpB and other subunits.

  • Quantum mechanical calculations: For detailed understanding of proton transfer mechanisms, including:

    • Protonation/deprotonation energetics of key residues

    • Transition state barriers for proton transfer

    • Effects of local electric fields on proton movement

  • Systems biology modeling: Integration of proteomic data from different growth conditions to predict how atpB expression and function correlate with broader metabolic adaptations in O. carboxidovorans .

These computational approaches can guide experimental design, help interpret experimental results, and generate testable hypotheses about the unique adaptations of O. carboxidovorans atpB.

How does O. carboxidovorans atpB differ from other bacterial homologs in sequence and predicted structure?

A comparative analysis of O. carboxidovorans atpB with other bacterial homologs would reveal important evolutionary adaptations:

FeatureO. carboxidovorans atpBTypical Bacterial atpBPotential Functional Significance
Transmembrane helices5-6 predicted (typical)5-6Core structural organization conserved
Critical arginine residuePresent (conserved)PresentEssential for proton translocation mechanism
Lipid-facing residuesMay show adaptationsVariableAdaptation to membrane composition differences based on growth mode
C-ring interfacePotentially specializedVariableMay reflect adaptation to different energetic conditions
N- and C-terminal regionsLikely divergentVariableOften involved in subunit interactions and regulation

The specific adaptations in O. carboxidovorans atpB likely reflect its ability to function efficiently under both heterotrophic and chemolithoautotrophic conditions, where the energetic landscape and membrane environment differ significantly .

What insights from other bacterial ATP synthases can be applied to O. carboxidovorans research?

Research on other bacterial ATP synthases provides valuable insights applicable to O. carboxidovorans:

  • Assembly mechanisms: Studies in yeast and other bacteria suggest ATP synthase assembly involves separate pathways (F₁/c-ring and a/A6L/stator subunits) that converge in the final stage. This model can guide investigation of O. carboxidovorans ATP synthase assembly .

  • Cryo-EM methodologies: Successful structural determination of bacterial ATP synthases, such as the Bacillus PS3 ATP synthase expressed in E. coli, provides technical approaches applicable to O. carboxidovorans ATP synthase .

  • Proton translocation mechanisms: The detailed understanding of the proton path through other bacterial ATP synthases can inform mutagenesis studies of O. carboxidovorans atpB to confirm conserved mechanisms or identify adaptations.

  • Genetic manipulation approaches: Techniques for expressing and studying bacterial ATP synthases in heterologous systems can be adapted for O. carboxidovorans ATP synthase, complemented by the recently established transformation protocols .

  • Oligomerization interfaces: Knowledge of dimer and oligomer formation in other ATP synthases can guide investigation of similar structures in O. carboxidovorans and their potential role in adaptation to different growth conditions .

How do the unique metabolic capabilities of O. carboxidovorans influence atpB evolution and function?

The unique metabolic flexibility of O. carboxidovorans, particularly its ability to grow chemolithoautotrophically using CO, CO₂, and H₂, has likely influenced the evolution and function of its atpB:

  • Adaptation to varying energy inputs: The ability to function with different energy sources (CO/H₂ oxidation versus acetate metabolism) may have selected for an atpB variant that can operate efficiently across varying proton motive force magnitudes and stability conditions .

  • Membrane composition responsiveness: The documented changes in membrane fatty acid composition between autotrophic and heterotrophic growth suggest atpB has evolved to function optimally in different lipid environments .

  • Integration with carbon fixation pathways: Expression analysis shows coordinated regulation of ATP synthase with carbon fixation via the Calvin-Benson-Bassham cycle during autotrophic growth, suggesting co-evolution of these systems .

  • Stress adaptation mechanisms: The oxidative stress response differs between growth conditions, potentially selecting for an atpB variant that maintains function under varying redox environments .

  • Genomic context: The location of genes for autotrophic growth (including hydrogenase) on a megaplasmid may have implications for the evolutionary history and regulation of ATP synthase components, potentially including specialized regulatory mechanisms for atpB expression under different growth conditions .

Understanding these evolutionary adaptations could provide insights into designing ATP synthases for biotechnological applications in varying environmental conditions.

What are the most promising applications of engineered O. carboxidovorans atpB in energy biotechnology?

Engineered O. carboxidovorans atpB holds significant potential for energy biotechnology applications:

  • Synthesis gas utilization optimization: Engineering atpB to enhance ATP synthase efficiency during growth on synthesis gas could improve the conversion of C1-containing industrial waste gases into valuable products .

  • Biofuel production systems: Modified atpB could contribute to engineered strains with improved energetic efficiency during autotrophic growth, enhancing production of biofuels from CO₂ and CO.

  • ATP regeneration systems: Engineered atpB variants could be incorporated into artificial systems for ATP regeneration in biocatalytic processes, potentially with improved stability or efficiency compared to current options.

  • Bioelectrochemical interfaces: Specialized atpB variants could facilitate direct electron transfer from electrodes to drive ATP synthesis, creating new bioelectrochemical systems for energy conversion.

  • Environmental sensors: ATP synthase containing engineered atpB could serve as sensitive biological detectors for environmental contaminants that affect membrane integrity or proton gradients.

These applications leverage O. carboxidovorans' unique ability to function under both heterotrophic and autotrophic conditions, potentially creating versatile energy conversion systems for various biotechnological contexts .

What key questions remain unanswered about O. carboxidovorans atpB structure and function?

Despite advances in understanding bacterial ATP synthases, several critical questions about O. carboxidovorans atpB remain unanswered:

  • Structural adaptations: How does the structure of atpB from O. carboxidovorans differ from other bacterial homologs, particularly in regions that might reflect adaptation to its unique metabolic capabilities?

  • Regulatory mechanisms: How is atpB expression regulated during transitions between heterotrophic and autotrophic growth, and what factors control its incorporation into the ATP synthase complex?

  • Proton pathway specifics: What are the exact residues forming the proton half-channels in O. carboxidovorans atpB, and do they show adaptations compared to other bacterial ATP synthases?

  • Membrane interaction: How does atpB function adapt to the documented changes in membrane fatty acid composition between growth conditions ?

  • Oligomerization patterns: Does O. carboxidovorans ATP synthase form dimers and higher oligomers similar to those observed in other systems, and how does this organization change between growth conditions ?

  • Integration with carbon fixation: How is ATP synthase activity coordinated with carbon fixation pathways during autotrophic growth, and what role does atpB play in this coordination ?

Addressing these questions will require integrated approaches combining structural biology, biochemistry, genetics, and systems biology.

How might synthetic biology approaches enhance our understanding of O. carboxidovorans atpB?

Synthetic biology approaches offer powerful strategies to advance understanding of O. carboxidovorans atpB:

  • Minimal ATP synthase design: Constructing simplified versions of ATP synthase containing atpB to identify the minimal components required for function under different conditions.

  • Domain swapping experiments: Creating chimeric proteins by swapping domains between atpB from O. carboxidovorans and other bacterial species to identify regions responsible for specific functional properties.

  • Orthogonal translation systems: Incorporating unnatural amino acids at specific positions in atpB to probe proton transfer mechanisms with novel chemical functionalities or to introduce bioorthogonal handles for advanced imaging.

  • Synthetic regulatory circuits: Developing artificial gene circuits to control atpB expression in response to defined signals, allowing precise temporal studies of ATP synthase assembly and function.

  • Minimal genome approaches: Simplifying the O. carboxidovorans genome to create strains with minimal metabolic capability but functional ATP synthase, facilitating clean analysis of atpB function without confounding metabolic variables.

  • Cell-free expression platforms: Utilizing cell-free systems to express atpB and other ATP synthase components in defined environments that mimic either heterotrophic or autotrophic conditions .

These synthetic biology approaches could overcome limitations of traditional genetic and biochemical methods, providing new insights into the structure, function, and regulation of O. carboxidovorans atpB.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.