Recombinant Oligotropha carboxidovorans ATP synthase subunit b/b' (atpG)

Shipped with Ice Packs
In Stock

Description

Introduction to ATP Synthase Subunit b/b' (atpG)

ATP synthase is a membrane-bound enzyme essential for generating ATP through proton translocation across cellular membranes. In Oligotropha carboxidovorans, the recombinant ATP synthase subunit b/b' (atpG) is a key component of the F₀ sector of the F₁F₀-ATP synthase complex. This subunit plays a critical role in stabilizing the peripheral stalk, which connects the catalytic F₁ headpiece to the membrane-embedded F₀ proton channel .

Role in Proton-Driven ATP Synthesis

The b/b' subunit anchors the peripheral stalk, ensuring efficient energy coupling between proton translocation and ATP synthesis. Studies in Thermus thermophilus demonstrate that mutations in analogous subunits disrupt proton flow and reduce ATP production .

Regulatory Interactions

The ε subunit (atpC) adopts two conformations during ATP synthesis and hydrolysis, modulating the b/b'-γ interaction. In the absence of γ, ε cannot couple proton flux to ATP synthesis, underscoring b/b'’s role in maintaining rotor-stator integrity .

Applications in Biomedical and Biotechnological Research

  1. Drug Target Development: The b/b' subunit is a candidate for modulating ATP synthase activity in metabolic disorders.

  2. Bioenergy Research: Recombinant atpG aids in studying proton-to-ATP conversion efficiency for biofuel applications.

  3. Structural Biology: Crystallography and cryo-EM studies utilize recombinant atpG to resolve F₁F₀-ATP synthase dynamics .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
atpF2; atpG; OCAR_4698; OCA5_c32520; ATP synthase subunit b 2; ATP synthase F(0 sector subunit b 2; ATPase subunit I 2; F-type ATPase subunit b 2; F-ATPase subunit b 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-187
Protein Length
full length protein
Species
Oligotropha carboxidovorans (strain ATCC 49405 / DSM 1227 / KCTC 32145 / OM5)
Target Names
atpF2
Target Protein Sequence
MAESHATGTTTHTEVPHGKPEFPPFNKDTFASQLVSFAIAFALLYVIVSRFALPRVGGVI KTREGTIEKDLAEAQAFRDESDLALKAYETELAAARTRAQAIGSETRDTLAAQSDAERKA VELSLSAKLAEAEKTISDMRTKAMGNVKAIAADATSAIVQQLSGTAPDAQLIDRAVDASL KGGRDAA
Uniprot No.

Target Background

Function
F1F0 ATP synthase synthesizes ATP from ADP using a proton or sodium gradient. This enzyme comprises two domains: F1, the extramembrane catalytic core; and F0, the membrane proton channel. These domains are linked by a central and peripheral stalk. ATP synthesis in the F1 catalytic domain is coupled to proton translocation via a rotary mechanism involving the central stalk subunits. The b'-subunit, a divergent duplicate of the b subunit, is a component of the F0 channel, forming part of the peripheral stalk and linking F1 to F0. This subunit is found in plants and photosynthetic bacteria.
Database Links
Protein Families
ATPase B chain family
Subcellular Location
Cell inner membrane; Single-pass membrane protein.

Q&A

What is Oligotropha carboxidovorans and why is its ATP synthase of interest?

Oligotropha carboxidovorans OM5 is a chemolithoautotrophic bacterium with the remarkable capability to utilize carbon monoxide, carbon dioxide, and hydrogen as energy sources. It was originally isolated from wastewater through enrichment culture studies designed to isolate CO-utilizing bacteria . Initially identified as Pseudomonas carboxidovorans, it was later reclassified as Oligotropha carboxidovorans . The organism belongs to the gram-negative family Bradyrhizobiaceae, which includes plant-associated species (e.g., Bradyrhizobium), animal-associated species (e.g., Afipia), and free-living bacteria (e.g., Rhodopseudomonas) .

ATP synthase in O. carboxidovorans is of particular interest due to the organism's unique energy metabolism that allows it to thrive in carbon-limited environments. The ATP synthase complex plays a critical role in energy production during both autotrophic and heterotrophic growth, making it an important target for understanding the adaptability of this organism .

How does the ATP synthase in O. carboxidovorans differ from ATP synthases in other organisms?

While the core mechanism of ATP synthesis is conserved across species, the ATP synthase of O. carboxidovorans likely contains specific adaptations that optimize its function in this unique organism. The ATP synthase genes in O. carboxidovorans are differentially expressed depending on growth conditions. During autotrophic growth with synthesis gas (CO₂, CO, and H₂), genes related to energy metabolism, including those encoding ATP synthase subunits, show significantly higher expression compared to heterotrophic growth with acetate .

These expression patterns suggest that the ATP synthase complex in O. carboxidovorans may be optimized for efficient energy conservation under the challenging conditions of autotrophic growth. Additionally, the b/b' subunit might have structural features that contribute to the stability of the ATP synthase complex under varying environmental conditions, though specific structural differences would require detailed comparative analyses with ATP synthases from other organisms .

What techniques can be used to study the interaction of ATP synthase subunit b/b' with other proteins?

Several complementary techniques can be employed to investigate protein-protein interactions involving ATP synthase subunit b/b':

  • Co-immunoprecipitation (Co-IP): This technique can identify protein-protein interactions by using antibodies to precipitate the target protein along with any binding partners. For studying ATP synthase interactions, researchers can use antibodies specific to the b/b' subunit or to potential interacting proteins .

  • Proximity Ligation Assay (PLA): This highly sensitive method can detect protein interactions in situ with high specificity. PLA generates fluorescent signals only when two proteins are in close proximity (≤40 nm). This technique has been successfully used to study interactions between α-synuclein and ATP synthase and could be adapted to study interactions involving the b/b' subunit .

  • Super-resolution microscopy: Techniques such as stimulated emission depletion (STED) microscopy or photoactivated localization microscopy (PALM) can visualize protein co-localization at nanometer resolution. These approaches overcome the diffraction limit of conventional microscopy and can provide spatial information about the interaction between ATP synthase subunits and other proteins .

  • Quantification methods: The association quotient (Q) can be calculated to measure coincidence between different protein localizations in imaging data. For instance, in studies of α-synuclein with ATP synthase, a Q value of 0.48 was determined, indicating substantial co-localization .

What expression systems are most effective for producing recombinant O. carboxidovorans ATP synthase subunit b/b'?

Based on current research methodologies for similar proteins, several expression systems can be considered for the production of recombinant O. carboxidovorans ATP synthase subunit b/b':

  • E. coli expression systems: These are commonly used for bacterial protein expression due to their high yield, rapid growth, and well-established protocols. For membrane-associated proteins like ATP synthase subunits, E. coli strains such as BL21(DE3) or C41(DE3) may be particularly suitable.

  • Homologous expression in O. carboxidovorans: Recent advances in genetic engineering of O. carboxidovorans make this an attractive option. Transformation via electroporation has been established, along with gene deletion and exchange protocols using two-step recombination. This approach allows for inducible and stable expression of genes in their native cellular environment .

  • Cell-free protein synthesis: This system bypasses cellular limitations and can be optimized for membrane proteins. It offers advantages for proteins that might be difficult to express in cellular systems due to toxicity or other factors.

For optimal expression, researchers should consider:

  • Using codon-optimized genes for the chosen expression system

  • Including affinity tags (His, GST, etc.) for purification

  • Optimizing induction conditions (temperature, inducer concentration, duration)

  • Adding stabilizing agents during purification to maintain protein integrity

What purification strategy would you recommend for isolating the recombinant ATP synthase subunit b/b'?

An effective purification strategy for recombinant ATP synthase subunit b/b' would typically involve:

  • Cell lysis: Depending on the expression system, use appropriate buffer conditions with protease inhibitors. For membrane-associated proteins, include detergents like n-dodecyl β-D-maltoside (DDM) or Triton X-100 to solubilize the protein.

  • Initial purification: Utilize affinity chromatography based on the tag incorporated into the recombinant protein. His-tagged proteins can be purified using Ni-NTA columns, while GST-tagged proteins can use glutathione sepharose.

  • Secondary purification: Apply size exclusion chromatography (SEC) to separate the target protein from contaminants based on molecular size. Ion exchange chromatography can also be used as an additional purification step if the isoelectric point of the protein is favorable.

  • Quality assessment: Evaluate protein purity using SDS-PAGE, and confirm identity via Western blotting or mass spectrometry. Circular dichroism spectroscopy can be used to assess proper folding of the purified protein.

For membrane proteins like ATP synthase subunits, maintaining a stable environment throughout purification is crucial. Consider using amphipathic molecules or nanodisc technology to mimic the membrane environment and prevent protein aggregation or denaturation.

How can the recombinant ATP synthase subunit b/b' be used to study bioenergetics in O. carboxidovorans?

The recombinant ATP synthase subunit b/b' provides a valuable tool for investigating the unique bioenergetic processes in O. carboxidovorans, particularly during its transition between heterotrophic and autotrophic growth modes:

  • Reconstitution studies: Purified recombinant subunit b/b' can be used for in vitro reconstitution of the ATP synthase complex. This allows researchers to study how the complex assembles and functions under different conditions that mimic autotrophic versus heterotrophic growth.

  • Site-directed mutagenesis: By creating specific mutations in the recombinant protein, researchers can identify critical residues involved in protein-protein interactions within the ATP synthase complex or in interactions with regulatory molecules.

  • Comparative bioenergetics: The recombinant protein enables comparative studies between the ATP synthase of O. carboxidovorans and those of other organisms, providing insights into adaptations that support energy conservation during carbon monoxide and carbon dioxide utilization .

  • Structure-function analysis: Structural studies (X-ray crystallography, cryo-EM) of the recombinant protein can reveal unique features that contribute to ATP synthase function during different metabolic modes in O. carboxidovorans.

What role does ATP synthase play in the autotrophic metabolism of O. carboxidovorans?

ATP synthase plays a central role in energy conservation during autotrophic growth of O. carboxidovorans:

  • Energy coupling: During autotrophic growth on CO, CO₂, and H₂, O. carboxidovorans generates a proton motive force through the oxidation of CO (via CO dehydrogenase) and H₂ (via hydrogenase). The ATP synthase harnesses this proton gradient to synthesize ATP, which is then used for CO₂ fixation via the Calvin-Benson-Bassham cycle .

  • Differential expression: RNA-Seq analysis has revealed that genes encoding ATP synthase components, along with CO dehydrogenase and hydrogenase, show significantly higher expression during autotrophic growth compared to heterotrophic growth with acetate. This differential expression highlights the critical importance of ATP synthase in the energy metabolism during autotrophy .

  • Metabolic integration: The ATP synthase functions as part of an integrated metabolic network that enables O. carboxidovorans to thrive on gaseous substrates. The energy generated by ATP synthase supports not only CO₂ fixation but also other ATP-demanding processes required for growth under these challenging conditions .

The following table summarizes key differential expression data related to energy metabolism genes during autotrophic versus heterotrophic growth:

Protein/ComplexGene LocationExpression Change (Autotrophic vs. Heterotrophic)Function
ATP synthase componentsChromosomalSignificantly upregulatedATP synthesis
CO dehydrogenaseMegaplasmid pHCG3Highly upregulatedCO metabolism
HydrogenaseMegaplasmid pHCG3Highly upregulatedH₂ utilization
Calvin-Benson-Bassham cycle enzymesMegaplasmid pHCG3Highly upregulatedCO₂ fixation

How can genetic engineering approaches be used to study ATP synthase function in O. carboxidovorans?

Recent advances in genetic manipulation techniques for O. carboxidovorans provide powerful tools for studying ATP synthase function:

  • Gene deletion and replacement: Using the established two-step recombination protocols, researchers can create knockout mutants of ATP synthase subunits to assess their specific roles in energy metabolism. The atpG gene encoding subunit b/b' can be deleted or modified to evaluate its contribution to ATP synthase assembly and function .

  • Reporter gene fusions: By creating fusions between ATP synthase genes and reporter genes (such as GFP or luciferase), researchers can monitor the expression patterns of these genes under different growth conditions, providing insights into the regulation of ATP synthase in response to environmental changes .

  • Site-directed mutagenesis in vivo: Specific mutations can be introduced into the chromosomal copy of the atpG gene to study structure-function relationships in the native cellular context.

  • Heterologous expression: The successful transformation protocol for O. carboxidovorans enables the introduction of modified or heterologous ATP synthase components, allowing for comparative studies or the creation of hybrid enzyme complexes .

The genetic engineering workflow typically involves:

  • Design of targeting constructs with homology arms flanking the region of interest

  • Transformation via electroporation (parameters optimized for O. carboxidovorans)

  • Selection of transformants using appropriate markers

  • Verification of genetic modifications via PCR, sequencing, or functional assays

  • Phenotypic characterization of mutants under various growth conditions

What are the key considerations in designing experiments to study the interaction between ATP synthase and other cellular components?

When designing experiments to investigate ATP synthase interactions with other cellular components in O. carboxidovorans, researchers should consider:

  • Growth conditions: Establish clearly defined conditions for both autotrophic (CO, CO₂, H₂) and heterotrophic (acetate) growth to ensure reproducibility. Monitor growth parameters (OD, gas consumption) to harvest cells at consistent physiological states .

  • Sample preparation: For membrane protein complexes like ATP synthase, proper membrane isolation and solubilization are critical. Test different detergents (DDM, digitonin, etc.) to identify optimal conditions that maintain native protein interactions.

  • Controls and validation: Include multiple complementary techniques to validate interactions. For example, if co-immunoprecipitation suggests an interaction, confirm with in situ techniques like proximity ligation assay or fluorescence microscopy .

  • Quantification methods: Develop robust quantification strategies for interaction studies. The association quotient (Q) used in studies of other ATP synthase interactions provides a mathematical framework for assessing co-localization in imaging data .

  • Physiological relevance: Design experiments that link the observed molecular interactions to physiological outcomes, such as changes in ATP production, growth rates, or adaptation to different carbon sources.

What challenges might researchers encounter when working with the recombinant ATP synthase subunit b/b' and how can they be addressed?

Working with recombinant ATP synthase subunit b/b' presents several challenges:

  • Protein stability issues:

    • Challenge: Membrane proteins often become unstable when removed from their native lipid environment.

    • Solution: Use stabilizing agents such as glycerol (10-20%) in purification buffers; consider nanodiscs or amphipols to maintain a membrane-like environment.

  • Solubility problems:

    • Challenge: The hydrophobic nature of membrane protein subunits can lead to aggregation.

    • Solution: Screen multiple detergents at various concentrations; consider fusion tags that enhance solubility (MBP, SUMO); optimize buffer conditions (pH, salt concentration).

  • Low expression yields:

    • Challenge: Membrane proteins often express poorly in heterologous systems.

    • Solution: Test different expression systems; optimize codon usage; consider lower induction temperatures (16-25°C) and longer expression times; use specialized strains designed for membrane protein expression.

  • Functional assessment:

    • Challenge: Determining if the recombinant protein is properly folded and functional.

    • Solution: Develop activity assays specific to the b/b' subunit function; assess binding to known interaction partners; use circular dichroism to evaluate secondary structure.

  • Protein-specific antibodies:

    • Challenge: Lack of specific antibodies for O. carboxidovorans ATP synthase subunits.

    • Solution: Generate custom antibodies using purified recombinant protein or synthesized peptides from unique regions of the sequence; validate antibody specificity using knockout strains or heterologous expression systems.

How can researchers resolve contradictory data when studying ATP synthase function in different experimental systems?

When faced with contradictory results in ATP synthase research:

  • Systematic comparison of experimental conditions:

    • Create a comprehensive table comparing all experimental variables: growth conditions, cell harvesting methods, buffer compositions, protein isolation techniques, and assay conditions.

    • Identify specific differences that might account for contradictory results.

  • Sequential simplification:

    • Break down complex experimental systems into simpler components to isolate variables.

    • For example, if in vivo and in vitro results differ, systematically add components to the in vitro system to replicate the cellular environment.

  • Cross-validation with multiple techniques:

    • Apply orthogonal methods to address the same question. For instance, if binding studies using surface plasmon resonance contradict co-immunoprecipitation results, add fluorescence-based techniques or isothermal titration calorimetry.

    • Prioritize techniques that measure direct physical interactions over indirect functional assays when resolving contradictions about protein-protein interactions.

  • Consideration of physiological context:

    • Evaluate whether differences in the energetic state of the cells or membrane potential might explain contradictory results.

    • For O. carboxidovorans specifically, consider how the metabolic mode (autotrophic vs. heterotrophic) might influence ATP synthase structure, interactions, or regulation .

  • Statistical analysis and replication:

    • Ensure adequate statistical power through appropriate replication.

    • Consider meta-analysis approaches to integrate data from multiple experiments or studies.

What are the potential applications of engineered O. carboxidovorans ATP synthase in sustainable biotechnology?

The unique properties of O. carboxidovorans and its ATP synthase offer several promising applications for sustainable biotechnology:

  • Carbon capture and utilization: Engineered strains with optimized ATP synthase could enhance the organism's ability to fix CO₂ and utilize CO from industrial waste gases, contributing to carbon capture technologies while producing valuable compounds .

  • Bioenergy applications: Modified ATP synthase variants might improve energy conversion efficiency during autotrophic growth, potentially enhancing the production of biofuels or other high-energy compounds using synthesis gas as a feedstock .

  • Biosensors for environmental monitoring: The regulatory mechanisms of ATP synthase expression in response to different carbon sources could be harnessed to develop biosensors for monitoring CO or CO₂ levels in industrial settings.

  • Synthetic biology platforms: The genetic tractability of O. carboxidovorans, combined with its unique metabolic capabilities, provides opportunities for developing synthetic biology platforms that can produce ATP-intensive products using waste gases as feedstocks .

  • Model systems for understanding energy conservation: Engineered variants of ATP synthase in O. carboxidovorans could serve as model systems for understanding fundamental principles of energy conservation in chemolithoautotrophic metabolism.

What structural aspects of ATP synthase subunit b/b' remain unexplored but crucial for understanding its function?

Several key structural aspects of ATP synthase subunit b/b' warrant further investigation:

  • Conformational dynamics during catalysis: The b/b' subunit serves as part of the stator in ATP synthase, but how its structure responds to the rotational catalysis occurring in other parts of the complex remains poorly understood. Advanced techniques like hydrogen-deuterium exchange mass spectrometry (HDX-MS) or single-molecule FRET could reveal these dynamic aspects.

  • Interaction interfaces with other subunits: The precise molecular details of how the b/b' subunit interacts with other components of the ATP synthase complex in O. carboxidovorans have not been determined. Cryo-EM studies of the intact complex could provide this structural information.

  • Adaptations specific to O. carboxidovorans: Comparative structural analysis between ATP synthase b/b' subunits from O. carboxidovorans and other bacteria could reveal adaptations that support the unique metabolic capabilities of this organism, particularly during autotrophic growth .

  • Post-translational modifications: The presence and functional significance of potential post-translational modifications in the b/b' subunit, which might regulate ATP synthase activity in response to changing metabolic conditions, remain to be explored.

  • Membrane interactions: The specific lipid interactions that may influence the structure and function of the b/b' subunit within the membrane environment of O. carboxidovorans merit investigation, particularly given the different membrane compositions that might exist during autotrophic versus heterotrophic growth.

How might the study of O. carboxidovorans ATP synthase contribute to understanding evolutionary adaptations in energy metabolism?

Investigating O. carboxidovorans ATP synthase offers unique insights into evolutionary adaptations of energy metabolism:

  • Metabolic versatility: O. carboxidovorans can switch between heterotrophic and autotrophic growth modes, making it an excellent model for studying how ATP synthase has evolved to support metabolic flexibility. Comparative studies of ATP synthase regulation and structure under different growth conditions can reveal adaptations that enable this versatility .

  • Specialized energy conservation: The ability to grow on carbon monoxide represents a specialized form of energy metabolism. Studying how ATP synthase in O. carboxidovorans has adapted to efficiently couple with CO oxidation pathways could reveal evolutionary innovations in energy conservation mechanisms .

  • Genomic context: The complete genome sequence of O. carboxidovorans provides context for understanding the evolution of its energy metabolism. Analysis of the ATP synthase genes in relation to other metabolic genes, particularly those on the megaplasmid pHCG3, can reveal evolutionary patterns such as gene clustering, horizontal gene transfer, or co-evolution of metabolic modules .

  • Adaptation to extreme energy limitation: O. carboxidovorans thrives in environments with limited carbon and energy sources. Studying its ATP synthase may reveal adaptations that maximize energy conservation efficiency under these challenging conditions, providing insights into evolutionary strategies for energy optimization.

  • Comparative genomics approach: Systematic comparison of ATP synthase components across the Bradyrhizobiaceae family and related bacteria with diverse metabolic capabilities could identify specific adaptations in O. carboxidovorans that correlate with its unique metabolic traits .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.