Recombinant Oligotropha carboxidovorans Large-conductance mechanosensitive channel (mscL)

What is the Oligotropha carboxidovorans mscL protein and what is its primary function?

The Oligotropha carboxidovorans mscL protein is a large-conductance mechanosensitive channel that functions as a pressure relief valve in bacterial cells. Similar to other MscL proteins, it likely responds to membrane tension by opening a large pore, allowing the passage of ions and small molecules to prevent cell lysis during osmotic downshock. The full-length protein consists of 138 amino acids and contains characteristic structural elements including an amphipathic N-terminal region that plays a crucial role in mechanosensory transduction . The protein's sequence (MLKEFREFAMKGNVVDLAVGVIIGAAFGAIVSSLVGDVIMPVIGAITGGLDFSNYFIGLS KEVTATNLVDAKKQGAVLAYGSFLTVTLNFLIIAFVLFIVIRLINRIKRSEEAKPAEAPA PTKDQVLLTEIRDILKTK) reveals structural motifs common to mechanosensitive channels .

How does the mscL gene relate to bacterial adaptation mechanisms?

The mscL gene (also annotated as OCAR_5831 or OCA5_c21850 in Oligotropha carboxidovorans) encodes a protein essential for bacterial adaptation to rapid changes in osmotic pressure . In the broader context of bacterial adaptation, mechanosensitive channels like mscL represent a fundamental survival mechanism that allows bacteria to sense and respond to mechanical forces in their environment. In Oligotropha carboxidovorans, the mscL gene may have unique adaptations related to the organism's carboxydotrophic lifestyle, potentially working in concert with other stress response systems to maintain cellular integrity under various environmental conditions .

What are the key structural elements of mscL involved in mechanosensory transduction?

Research indicates that several key structural elements in mscL are critical for mechanosensory transduction. Most notably, the amphipathic N-terminal helix has been identified as a crucial structural component during tension-induced gating. This region serves a dual function: stabilizing the closed state of the channel and coupling the channel to the membrane .

The mechanosensitive properties of the channel rely on the direct transmission of mechanical force from the lipid bilayer to the channel protein. The structural arrangement allows the protein to sense changes in membrane tension and undergo conformational changes that lead to channel opening. This mechanism represents an excellent model system for studying the basic biophysical principles of mechanosensory transduction .

How does the amphipathic N-terminus of mscL contribute to channel gating?

The amphipathic N-terminus of mscL plays a pivotal role in channel gating through multiple mechanisms:

• Closed state stabilization: The N-terminal helix helps maintain the channel in its closed configuration under normal conditions.

• Membrane coupling: This region acts as a critical interface between the channel and the lipid bilayer, allowing efficient transmission of membrane tension forces to the channel.

• Conformational change coordination: During gating, the N-terminal region undergoes specific conformational changes that facilitate the transition from closed to open states .

Research using multiple experimental and computational approaches has demonstrated that this amphipathic helix represents a common structural principle in the gating cycle of mechanosensitive channels . The precise interaction between the N-terminus and other regions of the channel protein creates a finely tuned system that responds to specific threshold levels of membrane tension.

What are the optimal conditions for expressing and purifying recombinant Oligotropha carboxidovorans mscL?

Based on established protocols for recombinant production of Oligotropha carboxidovorans mscL:

Expression System:

• Host organism: E. coli expression system

• Vector design: Incorporation of an N-terminal His-tag for purification

• Protein length: Full-length protein (138 amino acids)

Purification Protocol:

• Expression in E. coli followed by cell lysis

• Affinity chromatography using His-tag

• Buffer conditions: Tris/PBS-based buffer, pH 8.0

• Final preparation: Lyophilized powder with 6% Trehalose as stabilizer

Storage Recommendations:

• Store at -20°C/-80°C upon receipt

• Aliquot to avoid repeated freeze-thaw cycles

• Working aliquots can be stored at 4°C for up to one week

Reconstitution Guidelines:

• Briefly centrifuge vial before opening

• Reconstitute in deionized sterile water to 0.1-1.0 mg/mL

• Add 5-50% glycerol (typically 50%) for long-term storage

• Store reconstituted protein at -20°C/-80°C

What biophysical techniques are most informative for studying mscL gating mechanisms?

Multiple complementary approaches have proven valuable for investigating mscL gating mechanisms:

• Electrophysiology techniques: Patch-clamp recordings provide direct measurements of channel activity and conductance under controlled membrane tension conditions.

• Structural biology approaches:

  • X-ray crystallography to determine high-resolution structures of closed or intermediate states

  • Cryo-electron microscopy to visualize different conformational states

  • NMR spectroscopy to analyze dynamic structural changes

• Computational methods:

  • Molecular dynamics simulations to model tension-induced conformational changes

  • Analysis of the mechanosensory transduction process at the atomic level

• Biochemical and biophysical approaches:

  • Site-directed mutagenesis combined with functional assays

  • Fluorescence resonance energy transfer (FRET) to monitor conformational changes

  • Lipid bilayer reconstitution systems to control membrane environment

These techniques, often used in combination, have been instrumental in establishing that the amphipathic N-terminal helix acts as a crucial structural element during tension-induced gating .

What is known about the genetic context of the mscL gene in Oligotropha carboxidovorans?

The mscL gene in Oligotropha carboxidovorans is identified by several annotations including mscL, OCAR_5831, and OCA5_c21850 . While detailed information about its genomic context is limited in the available search results, we can note:

• The gene encodes a 138-amino acid protein that functions as a large-conductance mechanosensitive channel .

• In the broader context of Oligotropha carboxidovorans genomics, the organism is known for its megaplasmid pHCG3, which carries genes essential for its carboxydotrophic lifestyle .

• The genomic organization of stress response systems in O. carboxidovorans likely shows some similarities to other carboxydotrophs like Carboxydothermus species, where specialized gene clusters coordinate responses to environmental challenges .

How can mutagenesis approaches be applied to study structure-function relationships in O. carboxidovorans mscL?

Site-directed mutagenesis represents a powerful approach for investigating structure-function relationships in the O. carboxidovorans mscL protein:

Key Regions for Mutagenesis:

• Amphipathic N-terminus: Targeted mutations in this region can help elucidate its precise role in channel gating and membrane coupling .

• Transmembrane domains: Mutations affecting membrane-spanning regions can provide insights into how mechanical force is transmitted through the protein structure.

• Gate region: Alterations to residues forming the channel gate can reveal mechanisms controlling pore opening and ion conductance.

Experimental Design Approach:

• Generate a library of point mutations targeting specific functional domains

• Express and purify mutant proteins using established protocols

• Assess functional consequences through:

  • Electrophysiological measurements of channel activity

  • Structural analyses of conformational changes

  • Bacterial osmotic shock survival assays

Such mutagenesis studies would build upon the fundamental understanding that the amphipathic N-terminal helix acts as a crucial structural element during tension-induced gating .

What computational methods are most effective for modeling mscL tension-induced gating?

Computational modeling of mscL tension-induced gating typically employs multiple complementary approaches:

• Molecular Dynamics (MD) Simulations:

  • All-atom MD simulations to model protein behavior in a lipid bilayer under tension

  • Coarse-grained simulations to access longer timescales relevant to the complete gating process

  • Targeted MD approaches to model specific transitions between conformational states

• Structural Bioinformatics:

  • Homology modeling to predict structural features based on related channels

  • Sequence conservation analysis to identify functionally important residues

  • Protein-lipid interaction modeling to understand membrane coupling

• Energy Landscape Analysis:

  • Free energy calculations to determine energetic barriers between different states

  • Principal component analysis to identify dominant motion modes during gating

These computational approaches have been successfully combined with experimental methods to demonstrate that the amphipathic N-terminal helix is essential for both stabilizing the closed state and coupling the channel to the membrane during mechanosensory transduction .