Recombinant Oligotropha carboxidovorans Undecaprenyl-diphosphatase (uppP)

Shipped with Ice Packs
In Stock

Description

Definition and Biochemical Role

Undecaprenyl-diphosphatase (uppP) is an enzyme critical for bacterial cell wall biosynthesis. It catalyzes the hydrolysis of undecaprenyl pyrophosphate (UPP) to undecaprenyl phosphate (UP), a reaction essential for recycling lipid carriers in peptidoglycan and glycolipid synthesis . This enzyme is also known as bacitracin resistance protein, as its activity counteracts bacitracin-mediated inhibition of UPP generation .

Key Attributes of Recombinant uppP

ParameterValue
SourceOligotropha carboxidovorans (strain ATCC 49405/DSM 1227/OM5)
Expression HostE. coli
TagN-terminal His tag (varies by manufacturer)
LengthFull-length (1-268 amino acids) or partial (specific to product)
EC Number3.6.1.27
Purity>85% (SDS-PAGE) or >90%
StorageLyophilized powder stored at -20°C/-80°C (aliquoted to avoid freeze-thaw cycles)

Sequence Comparison

SpeciesUniprot IDSequence LengthKey Features
Oligotropha carboxidovoransB6JCL3268 amino acidsFull-length; includes N-terminal His tag
Azospirillum brasilenseP39438187 amino acidsShorter isoform; partial sequence

Role in Metabolic Pathways

uppP is integral to lipid II synthesis, a precursor for peptidoglycan cross-linking. In Oligotropha carboxidovorans, this enzyme is chromosomally encoded and linked to central metabolic pathways, including glyoxylate shunt and fatty acid biosynthesis . RNA-Seq studies reveal differential expression under heterotrophic vs. chemolithoautotrophic growth, though uppP itself is not explicitly highlighted .

Target for Antibacterial Agents

Inhibitors of undecaprenyl-diphosphatase (e.g., rhodanines, resorcinols) disrupt cell wall synthesis, showing promise against Gram-positive pathogens like Staphylococcus aureus and Bacillus anthracis . While Oligotropha is not a clinical pathogen, its uppP serves as a model for studying UPPS inhibitor mechanisms .

Genomic Context

The uppP gene in Oligotropha carboxidovorans is located on the chromosome, distinct from the megaplasmid-encoded chemolithoautotrophic genes (cox, hox, cbb) . Genomic comparisons with Nitrobacter hamburgensis and Bradyrhizobium spp. reveal conserved metabolic pathways but unique regulatory adaptations .

Experimental Applications

Recombinant uppP is utilized in:

  • Biochemical Assays: Enzymatic activity validation using in vitro PPi release assays .

  • Structural Studies: Crystallography (though limited success reported) .

  • Antibiotic Development: Screening inhibitors for synergy with β-lactams or glycopeptides .

Handling Recommendations

ParameterGuideline
ReconstitutionSterile water (0.1–1.0 mg/mL); add 5–50% glycerol for stability
Storage BufferTris/PBS-based buffer with 6% trehalose (pH 8.0) or 50% glycerol
ThawingAvoid repeated freeze-thaw cycles; store aliquots at 4°C for ≤1 week

Future Directions

  • Mechanistic Studies: Elucidate uppP’s role in Oligotropha’s adaptation to syngas (CO/H₂) environments .

  • Metabolic Engineering: Explore uppP’s potential in engineering Oligotropha for industrial syngas-to-chemicals conversion .

  • Structural Biology: Resolve crystal structures to guide inhibitor design .

Product Specs

Form
Lyophilized powder
Note: While we will prioritize shipping the format currently in stock, we are flexible to accommodate specific format requirements. Please indicate your preferred format in the order notes, and we will do our best to fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for precise delivery timelines.
Note: Our proteins are routinely shipped with standard blue ice packs. Should you require dry ice shipping, please inform us in advance, as additional fees may apply.
Notes
Repeated freezing and thawing is discouraged. For optimal preservation, store working aliquots at 4°C for a maximum of one week.
Reconstitution
Prior to opening, we recommend briefly centrifuging the vial to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration ranging from 0.1 to 1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquotting for extended storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference point.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C, while lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Minimize repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
Tag type is determined during production. If you have a specific tag preference, please let us know, and we will prioritize developing the specified tag.
Synonyms
uppP; OCAR_4447; OCA5_c00850; Undecaprenyl-diphosphatase; Bacitracin resistance protein; Undecaprenyl pyrophosphate phosphatase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-268
Protein Length
full length protein
Species
Oligotropha carboxidovorans (strain ATCC 49405 / DSM 1227 / KCTC 32145 / OM5)
Target Names
uppP
Target Protein Sequence
MLFDLFKALVLGIVEGVTEFLPVSSTGHILLAERIFDLDQDNFWKTFAVLIQLGAILAIL AIYFQRLWRVATHMFTDPAARRFVIGVLVAFLPAVILGLIFGTFIKEVLFNPWVVCFSLI AGGAVLLWVDQQDVNPRHHDAMAFPLPMYLGIGIAQCAAMVPGVSRSGASIVAAMLFGAD KRAAAEFSFFLAIPTMLGAFVYDVYKSRGDMTMDHAFIIIVGFVVSFITAIVVVKTFLDF VTKNGFTFFAWWRVIVGTLGLIALALGA
Uniprot No.

Target Background

Function
Catalyzes the dephosphorylation of undecaprenyl diphosphate (UPP), conferring resistance to bacitracin.
Database Links
Protein Families
UppP family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Undecaprenyl-diphosphatase (uppP) and what is its biological function?

Undecaprenyl-diphosphatase (uppP), also known as Bacitracin resistance protein or Undecaprenyl pyrophosphate phosphatase (EC 3.6.1.27), is an integral membrane protein that catalyzes the dephosphorylation of undecaprenyl pyrophosphate (C55-PP) to undecaprenyl phosphate (C55-P) . This reaction is essential for bacterial cell wall synthesis as undecaprenyl phosphate serves as a carrier lipid in the peptidoglycan biosynthetic pathway. The enzyme facilitates the recycling of the lipid carrier, ensuring continuous peptidoglycan synthesis necessary for bacterial growth and survival . In Oligotropha carboxidovorans, uppP has been identified in genomic analyses and appears to be uniquely present in certain bacterial genomes associated with specific metabolic capabilities .

What are the structural characteristics of Oligotropha carboxidovorans uppP?

O. carboxidovorans uppP (from strain ATCC 49405/DSM 1227/OM5) is a full-length protein of 268 amino acids with a UniProt accession number of B6JCL3 . The protein is characterized by its hydrophobic nature, consistent with its role as an integral membrane protein. Its amino acid sequence begins with "MLFDLFKALVLGIVEGVTEFLPVSST..." and continues as documented in the product specifications . The protein likely contains multiple transmembrane domains that anchor it within the bacterial membrane, with specific regions oriented toward either the cytoplasmic or periplasmic sides. While no crystal structure of O. carboxidovorans uppP is currently available in public databases, computational models suggest a topology similar to other bacterial undecaprenyl-diphosphatases .

What conserved motifs are present in uppP enzymes and how do they contribute to catalytic function?

Two principal conserved motifs have been identified in uppP enzymes through sequence alignment analyses:

  • The (E/Q)XXXE motif: Located within the putative first transmembrane helix, this glutamate-rich motif is implicated in lipid substrate binding .

  • The PGXSRSXXT motif: Found in a large loop region of the protein, this sequence is proposed to form part of the enzyme's catalytic site .

Additionally, a conserved histidine residue appears to be essential for catalytic activity. Together, these structural elements form the enzyme active site, which computational modeling suggests is oriented toward the periplasmic space . This orientation has significant implications for the enzyme's biological function and potential as a drug target. The conserved residues likely participate in coordinating the pyrophosphate group of the substrate and facilitating hydrolysis through acid-base catalysis.

How can recombinant O. carboxidovorans uppP be expressed and purified for structural studies?

The expression and purification of recombinant O. carboxidovorans uppP presents challenges typical of membrane proteins. Based on available methodologies, a recommended protocol would include:

  • Gene optimization and vector design:

    • Codon optimization for expression host

    • Inclusion of affinity tags (His6 or bacteriorhodopsin fusion tag)

    • Selection of appropriate promoter systems

  • Expression conditions:

    • Use of specialized E. coli strains (C41(DE3), C43(DE3))

    • Induction at lower temperatures (16-25°C)

    • Defined media supplementation to enhance membrane protein expression

  • Membrane fraction isolation:

    • Gentle cell lysis via sonication or French press

    • Differential centrifugation to isolate membrane fractions

    • Detergent screening for optimal solubilization

  • Purification steps:

    • Immobilized metal affinity chromatography

    • Size exclusion chromatography for oligomeric state determination

    • Ion exchange chromatography for final polishing

The purified protein is typically stored in a Tris-based buffer containing 50% glycerol at -20°C or -80°C for extended storage . Working aliquots may be maintained at 4°C for up to one week, though repeated freeze-thaw cycles should be avoided to preserve enzymatic activity .

What experimental approaches can determine the enzymatic kinetics of uppP?

Several complementary approaches can be employed to characterize the enzymatic kinetics of uppP:

Table 1: Methodological Approaches for uppP Kinetic Analysis

MethodParameters MeasuredAdvantagesLimitations
Phosphate colorimetric assayInitial velocity, Vmax, KmSimple, high-throughput capabilityIndirect measurement
Radioisotope-based assayTurnover number, substrate specificityHigh sensitivity, direct measurementRequires radioactive handling
Coupled enzyme assayReal-time kineticsContinuous monitoringPotential interference
Malachite green assayPhosphate releaseHigher sensitivity than basic colorimetricBackground phosphate interference
LC-MSProduct formation, reaction intermediatesDirect substrate/product quantificationEquipment cost, complexity

A standard reaction mixture for phosphatase activity determination typically contains 50 mM Hepes (pH 7.0), 150 mM NaCl, and 10 mM MgCl₂ . Substrate concentrations should be varied (typically 0-100 μM undecaprenyl pyrophosphate) to determine Michaelis-Menten parameters. Optimally, reactions should be conducted across different pH values and temperatures to establish the enzyme's pH profile and temperature optima.

What approaches can be used to investigate the membrane topology of uppP?

Determining the membrane topology of uppP requires multiple complementary techniques:

  • Computational prediction methods:

    • Hydropathy analysis and transmembrane helix prediction

    • Signal sequence identification

    • Consensus topology prediction across multiple algorithms

  • Experimental topology mapping:

    • PhoA/LacZ fusion approach - creating fusion proteins with reporters that are active only in specific cellular compartments

    • Substituted cysteine accessibility method (SCAM) - selective labeling of exposed cysteine residues

    • Protease protection assays to identify accessible regions

  • Advanced structural determination:

    • Cryo-electron microscopy of membrane-embedded protein

    • NMR studies using selectively labeled protein

    • X-ray crystallography following stabilization with lipid cubic phase techniques

  • Cross-validation approaches:

    • Accessibility to membrane-impermeable reagents

    • Site-directed spin labeling combined with EPR spectroscopy

    • Fluorescence-based approaches using environment-sensitive probes

Current models of uppP suggest that both conserved motifs are localized near membrane interfaces, with evidence pointing toward a periplasmic orientation of the active site . This topology has significant implications for both the enzyme's biological function and approaches to inhibitor design.

How can site-directed mutagenesis be used to investigate the catalytic mechanism of uppP?

Site-directed mutagenesis represents a powerful approach for dissecting the catalytic mechanism of uppP:

  • Target residue selection based on:

    • Conserved motifs: (E/Q)XXXE and PGXSRSXXT

    • The catalytic histidine residue

    • Other highly conserved residues identified through multiple sequence alignment

  • Types of mutations to consider:

    • Alanine scanning - systematic replacement with alanine to identify essential residues

    • Conservative substitutions (E→D, H→K) to test specific chemical requirements

    • Cysteine substitutions for subsequent accessibility/modification studies

    • Incorporation of unnatural amino acids for mechanistic investigations

  • Functional characterization of mutants:

    • Enzymatic activity assays to determine kinetic parameters

    • pH-rate profiles to identify potential acid/base catalysts

    • Substrate analog studies to probe binding interactions

    • Inhibitor sensitivity to identify resistance mutations

  • Structural verification:

    • Circular dichroism spectroscopy to confirm structural integrity

    • Thermal shift assays to assess stability changes

    • Limited proteolysis to detect conformational alterations

This approach has been validated for E. coli uppP and can be adapted for O. carboxidovorans enzyme . Results from such studies can establish the role of specific residues in substrate binding, transition state stabilization, and catalysis.

What computational methods can be employed to model the substrate binding site of uppP?

In the absence of crystal structures, computational methods provide valuable insights into uppP structure and function:

  • Homology modeling approaches:

    • Template identification through fold recognition rather than sequence identity

    • Multiple template modeling to improve accuracy

    • Refinement with membrane-specific force fields

  • Ab initio modeling techniques:

    • Rosetta membrane ab initio modeling as mentioned in structural studies of related enzymes

    • Fragment-based assembly for transmembrane regions

    • Conformational sampling optimized for membrane proteins

  • Molecular dynamics simulations:

    • Embedding models in explicit lipid bilayers

    • Assessment of stability and conformational changes

    • Identification of water channels and substrate access routes

  • Substrate docking and binding site analysis:

    • Flexible docking of undecaprenyl pyrophosphate

    • Identification of key interaction points

    • Energy decomposition to quantify contribution of specific residues

  • Validation approaches:

    • Comparison with experimental mutagenesis data

    • Correlation with enzymatic activity patterns

    • Prediction and testing of inhibitor binding modes

These computational approaches have been successfully applied to similar systems and can provide testable hypotheses regarding the structural basis of uppP function .

How does uppP contribute to bacterial antibiotic resistance?

UppP plays several roles in antibiotic resistance mechanisms:

  • Direct role in bacitracin resistance:

    • UppP is alternatively named "Bacitracin resistance protein"

    • Bacitracin acts by binding to undecaprenyl pyrophosphate, preventing its recycling

    • Increased uppP expression or activity can overcome this inhibition by increasing the rate of conversion to undecaprenyl phosphate

  • Cell wall biosynthesis pathway resilience:

    • UppP contributes to maintaining peptidoglycan synthesis despite antibiotic pressure

    • Multiple homologs or isozymes may provide redundancy in this critical pathway

    • Mutations affecting regulation can lead to increased expression under stress conditions

  • Implications for broader antibiotic resistance:

    • The cell wall synthesis pathway targeted by uppP is also affected by other antibiotics like methicillin and vancomycin

    • Changes in uppP function may contribute to decreased susceptibility to these agents

    • Understanding uppP's role may help address mechanisms underlying MRSA and VRE

Research approaches to investigate these connections include:

  • Transcriptomic analysis comparing resistant vs. sensitive strains

  • Genetic knockout and complementation studies

  • Biochemical characterization of uppP variants from resistant isolates

  • Analysis of synergistic effects between uppP inhibitors and existing antibiotics

What experimental strategies can be used to screen for potential uppP inhibitors?

Developing screening approaches for uppP inhibitors involves multiple strategic considerations:

Table 2: Screening Strategies for UppP Inhibitors

Screening ApproachAdvantagesConsiderationsOutput Metrics
High-throughput phosphatase assaysDirectly measures enzyme inhibitionRequires purified protein, substrate availabilityIC50 values, inhibition kinetics
Whole-cell antibacterial screeningIdentifies compounds with cellular activityMay hit multiple targetsMIC values, selectivity indices
Structure-based virtual screeningCost-effective initial filteringDepends on model qualityBinding scores, interaction profiles
Fragment-based screeningIdentifies starting points for optimizationRequires biophysical methodsFragment hits, binding efficiency
Phenotypic screening for cell wall defectsIdentifies functional consequencesIndirect measure of uppP inhibitionMorphological changes, synergy with other antibiotics

For virtual screening approaches, current understanding of the enzyme active site suggests focusing on compounds that can interact with the (E/Q)XXXE and PGXSRSXXT motifs and the essential histidine residue . The periplasmic orientation of the active site also suggests potential accessibility to inhibitors that may not need to cross the cytoplasmic membrane.

Similar approaches have been successfully employed for targeting undecaprenyl diphosphate synthase (UPPS), another enzyme in the bacterial cell wall synthesis pathway . Compounds identified through such screens could potentially restore sensitivity to existing antibiotics by targeting novel steps in cell wall biosynthesis .

How can heterologous expression systems be optimized for functional characterization of uppP?

Optimizing heterologous expression of uppP requires addressing challenges specific to membrane proteins:

  • Host selection considerations:

    • E. coli strains specialized for membrane protein expression (C41/C43, Lemo21)

    • Alternative hosts (Pichia pastoris, insect cells) for complex proteins

    • Cell-free expression systems combined with lipid nanodiscs

  • Vector design optimization:

    • Inducible promoters with tunable expression levels

    • Fusion tags known to enhance membrane protein expression (MISTIC, GFP)

    • Signal sequences to direct membrane insertion

    • Bacteriorhodopsin as a fusion tag has been successfully used for uppP

  • Expression condition optimization:

    • Temperature reduction to slow folding and membrane insertion

    • Chemical chaperones (glycerol, DMSO) to aid folding

    • Specialized media formulations

    • Strategic induction protocols (time, concentration)

  • Detergent and lipid considerations:

    • Systematic screening of detergents for solubilization

    • Lipid supplementation during expression

    • Reconstitution into proteoliposomes or nanodiscs for functional studies

  • Functional verification approaches:

    • Activity assays to confirm proper folding

    • Thermal stability assessment

    • Inhibitor binding profiles compared to native enzyme

The successful expression of active uppP enables detailed biochemical and biophysical characterization, providing insights into function and facilitating inhibitor discovery efforts.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.