Recombinant Oligotropha carboxidovorans UPF0060 membrane protein OCAR_5428/OCA5_c25530 (OCAR_5428, OCA5_c25530)

What is the UPF0060 membrane protein OCAR_5428/OCA5_c25530 and what are its structural characteristics?

The UPF0060 membrane protein OCAR_5428/OCA5_c25530 is a 110-amino acid membrane protein encoded by the Oligotropha carboxidovorans genome. The protein sequence is MTSLAAFVGAALMEIGGCFAFWAWLRLGQSPLWLIPGMAALALFAYLLTLVDSPLAGRAYAAYGGIYIASALVWGWAMEGHRPDRWDVAGATICLIGMAVILFGPRPAAL . This protein belongs to the UPF0060 family of membrane proteins, which are relatively uncharacterized functionally. The amino acid composition and sequence analysis suggest it's an integral membrane protein with multiple transmembrane domains. The protein contains hydrophobic regions consistent with membrane-spanning segments, which is characteristic of proteins embedded in cell membranes .

How is recombinant OCAR_5428/OCA5_c25530 protein typically expressed and purified for research purposes?

Recombinant OCAR_5428/OCA5_c25530 is typically expressed in E. coli expression systems with an N-terminal His tag to facilitate purification . The expression construct contains the full-length protein (amino acids 1-110) fused to the tag. For purification, standard immobilized metal affinity chromatography (IMAC) techniques are employed to isolate the His-tagged protein. The purified protein is typically provided as a lyophilized powder with greater than 90% purity as determined by SDS-PAGE . Researchers should reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL, and it's recommended to add glycerol (typically 5-50% final concentration) for long-term storage stability .

What is known about the physiological context of OCAR_5428/OCA5_c25530 in Oligotropha carboxidovorans?

Oligotropha carboxidovorans is a chemolithoautotrophic bacterium capable of utilizing CO and H₂ to derive energy for CO₂ fixation . While the specific function of OCAR_5428/OCA5_c25530 has not been fully characterized, proteomic studies have shown that O. carboxidovorans adapts its proteome significantly between heterotrophic growth (on substrates like acetate) and chemolithoautotrophic growth (using syngas components) . The bacterium also changes its membrane fatty acid composition between these growth conditions . As a membrane protein, OCAR_5428/OCA5_c25530 may potentially play a role in these adaptive processes, particularly in membrane composition or function during different metabolic states. The protein could be involved in maintaining membrane integrity or transport functions as part of cellular adaptations to different growth conditions .

How can researchers effectively design experiments to elucidate the function of OCAR_5428/OCA5_c25530?

Effective experimental design to determine the function of OCAR_5428/OCA5_c25530 should employ multiple complementary approaches. Begin with comparative expression analysis using RNA-Seq and proteomics across different growth conditions (heterotrophic vs. autotrophic) to identify correlated expression patterns with known genes . This correlation analysis can provide initial functional hypotheses. Next, implement gene deletion and complementation studies using the recently established transformation and gene editing protocols for O. carboxidovorans . Phenotypic characterization of deletion mutants should include growth rate analysis, membrane integrity assays, stress response testing, and metabolite profiling. For protein-level studies, conduct protein-protein interaction experiments using pull-down assays, bacterial two-hybrid systems, or cross-linking approaches to identify interaction partners. Membrane localization studies using GFP fusions or immunolocalization can determine subcellular distribution patterns. Additionally, reconstitute the purified protein into liposomes to test for potential transport activities or membrane-modifying functions. Integrate these approaches with metabolic flux analysis under various growth conditions to determine if the protein affects specific metabolic pathways .

What methodologies are most effective for studying membrane protein interactions of OCAR_5428/OCA5_c25530 in the context of O. carboxidovorans metabolism?

For studying OCAR_5428/OCA5_c25530 membrane protein interactions in O. carboxidovorans metabolism, researchers should implement a multi-tiered experimental approach. Begin with chemical cross-linking coupled with mass spectrometry (XL-MS) using membrane fractions isolated from cells grown under different metabolic conditions . This technique can capture transient interactions within the native membrane environment. For more specific interaction analysis, employ co-immunoprecipitation with antibodies against the native protein or its tagged version, followed by proteomic identification of binding partners. Complement these approaches with proximity-based labeling methods like BioID or APEX2, where the protein of interest is fused to a proximity-labeling enzyme that tags nearby proteins for subsequent purification and identification. To validate identified interactions, implement molecular dynamics simulations and computational docking studies based on predicted structural models. For functional validation, conduct metabolic profiling of wild-type versus knockout strains using techniques like gas chromatography-mass spectrometry (GC-MS) or liquid chromatography-mass spectrometry (LC-MS) to identify metabolic pathways affected by the protein's absence. This should be performed under both heterotrophic and autotrophic growth conditions to identify condition-specific metabolic roles .

How does the expression of OCAR_5428/OCA5_c25530 relate to the adaptive responses observed during metabolic switching in O. carboxidovorans?

The expression of OCAR_5428/OCA5_c25530 likely relates to adaptive responses during metabolic switching in O. carboxidovorans, though specific expression data for this protein wasn't directly mentioned in the available search results. Studies have shown that O. carboxidovorans undergoes significant proteomic changes when switching between heterotrophic growth (using acetate) and chemolithoautotrophic growth (using syngas components) . These adaptations involve changes in cell envelope composition, oxidative homeostasis mechanisms, and metabolic pathways including the glyoxylate shunt and amino acid/cofactor biosynthesis . The fatty acid methyl ester (FAME) analysis has demonstrated that the bacterium alters its membrane fatty acid composition when grown on different substrates . As a membrane protein, OCAR_5428/OCA5_c25530 may be directly involved in these membrane composition changes or may play a role in signaling or transport processes that facilitate metabolic adaptation. RNA-Seq analyses of O. carboxidovorans have identified genes that are differentially expressed between heterotrophic and autotrophic growth conditions, particularly those involved in CO₂ fixation, CO metabolism, and H₂ utilization . Investigating whether OCAR_5428/OCA5_c25530 is among these differentially expressed genes would provide valuable insights into its potential role in metabolic adaptation.

What are the optimal storage and handling conditions for maintaining the stability and activity of recombinant OCAR_5428/OCA5_c25530?

The optimal storage and handling conditions for maintaining stability and activity of recombinant OCAR_5428/OCA5_c25530 require careful attention to several factors. The protein is typically supplied as a lyophilized powder and should be stored at -20°C/-80°C upon receipt . Prior to opening, the vial should be briefly centrifuged to bring contents to the bottom. For reconstitution, use deionized sterile water to achieve a concentration of 0.1-1.0 mg/mL . For long-term storage stability, it's essential to add glycerol to a final concentration of 5-50% (with 50% being recommended by some suppliers) and then aliquot the solution to avoid repeated freeze-thaw cycles . The reconstituted protein should be stored at -20°C/-80°C for extended storage periods. For short-term work, working aliquots can be maintained at 4°C for up to one week . The storage buffer typically consists of a Tris/PBS-based buffer with 6% trehalose at pH 8.0 or a Tris-based buffer with 50% glycerol optimized for this specific protein . It's critical to avoid repeated freeze-thaw cycles as this can significantly reduce protein activity and stability. For experiments requiring multiple uses, prepare small working aliquots to minimize freeze-thaw events .

How can researchers efficiently optimize recombinant expression of OCAR_5428/OCA5_c25530 to maximize yield and functionality?

Optimizing recombinant expression of OCAR_5428/OCA5_c25530 requires a systematic approach addressing multiple variables affecting membrane protein production. First, evaluate multiple expression hosts beyond standard E. coli BL21(DE3), including C41(DE3) and C43(DE3) strains specifically designed for membrane protein expression, or consider Pseudomonas-based systems that may better accommodate proteins from related bacterial species . For vector design, test different promoter strengths (T7, tac, araBAD) and fusion tags beyond His-tags, such as MBP or SUMO, which can enhance solubility. Optimize codon usage for the chosen expression host while maintaining regions important for translation regulation. For induction conditions, perform a factorial design experiment varying temperature (16-30°C), inducer concentration, and induction duration, with lower temperatures often favoring proper membrane protein folding. Supplement growth media with specific phospholipids or membrane-stabilizing compounds like glycerol or specific detergents at sub-micellar concentrations. Consider co-expression with chaperones like GroEL/GroES or membrane-specific insertion factors to facilitate proper folding and membrane integration. For extraction and purification, evaluate multiple detergents including DDM, LMNG, or GDN, which are gentle and effective for maintaining membrane protein structure. Implement a high-throughput screening approach using GFP fusion constructs to rapidly assess expression conditions before scaling up to production levels .

What are common challenges in studying OCAR_5428/OCA5_c25530 and how can researchers overcome them?

Researchers face several challenges when studying the OCAR_5428/OCA5_c25530 membrane protein. Low expression yields are common with membrane proteins; this can be addressed by screening multiple expression systems, fusion partners, and growth conditions as detailed in section 3.3. Protein aggregation during purification is another frequent issue; researchers should optimize detergent selection through a systematic screen of different detergent types and concentrations, consider using stabilizing additives like cholesterol hemisuccinate or specific lipids, and implement size-exclusion chromatography as a final purification step to remove aggregates. Functional assays present challenges due to the uncharacterized nature of UPF0060 family proteins; researchers should develop multiple complementary assay types including binding assays, activity screens based on potential substrates, and in vivo functional complementation tests. Limited structural information about UPF0060 family proteins complicates interpretation; researchers can use comparative sequence analysis with other UPF0060 proteins, perform structure prediction using the latest deep learning approaches like AlphaFold2, and validate predictions with limited experimental data from crosslinking or hydrogen-deuterium exchange. The physiological relevance of in vitro findings can be difficult to establish; researchers should correlate in vitro observations with in vivo experiments using genetic knockouts or modifications in O. carboxidovorans, and conduct experiments under conditions that mimic the native environment of the protein .

What statistical approaches are most appropriate for analyzing experimental data related to OCAR_5428/OCA5_c25530 expression and function?

When analyzing experimental data related to OCAR_5428/OCA5_c25530 expression and function, researchers should employ statistical approaches tailored to the specific experimental design and data type. For expression level comparisons across different conditions (such as heterotrophic versus autotrophic growth), use analysis of variance (ANOVA) followed by appropriate post-hoc tests when comparing multiple conditions, or t-tests for pairwise comparisons, ensuring that assumptions of normality and homoscedasticity are met . For RNA-Seq data analysis, implement specialized statistical packages like DESeq2 or EdgeR that account for the negative binomial distribution of count data and provide appropriate normalization and false discovery rate control . When analyzing proteomic data, use specialized software such as MaxQuant or Proteome Discoverer with appropriate statistical models for label-free quantification or isotope labeling approaches, and implement normalization methods that account for technical variation . For correlation analyses between expression levels and physiological parameters, calculate Pearson's or Spearman's correlation coefficients depending on whether the relationship is expected to be linear or monotonic, respectively. When analyzing functional assays with potential outliers, consider robust statistical methods such as bootstrapping or permutation tests. For complex datasets involving multiple variables, implement multivariate approaches such as principal component analysis (PCA) or partial least squares discriminant analysis (PLS-DA) to identify patterns and relationships across the dataset. Finally, for all statistical analyses, report effect sizes alongside p-values to provide information about the magnitude of observed differences, and consider statistical power calculations when designing experiments to ensure sufficient sample sizes .

How might OCAR_5428/OCA5_c25530 be involved in the metabolic engineering of O. carboxidovorans for biotechnological applications?

OCAR_5428/OCA5_c25530 could play a significant role in metabolic engineering of O. carboxidovorans for biotechnological applications, particularly in processes utilizing C1-containing gases. As a membrane protein, it may influence cellular adaptation to different carbon sources and environmental conditions, which is crucial for optimizing industrial bioprocesses . Recent advances in establishing transformation and gene editing protocols for O. carboxidovorans provide the necessary tools to manipulate OCAR_5428/OCA5_c25530 expression and study its effects on syngas utilization efficiency . If this protein is involved in membrane adaptations during metabolic shifting between heterotrophic and autotrophic growth, as suggested by proteomic studies, modulating its expression could potentially enhance the stability of engineered strains under industrial conditions . The protein might also influence membrane permeability to gaseous substrates (CO, CO₂, H₂) or contribute to stress tolerance mechanisms essential for industrial-scale fermentations. Comparative proteomic analyses have shown that adaptation to chemolithoautotrophic growth involves changes in cell envelope, oxidative homeostasis, and metabolic pathways including the glyoxylate shunt and amino acid/cofactor biosynthesis . If OCAR_5428/OCA5_c25530 participates in these adaptive processes, its targeted engineering could improve O. carboxidovorans performance as a platform organism for sustainable production of chemicals from waste gases or syngas, addressing critical needs in developing eco-friendly industrial production routes .

What novel analytical techniques might advance our understanding of OCAR_5428/OCA5_c25530 structure-function relationships?

Emerging analytical techniques offer promising avenues to advance our understanding of OCAR_5428/OCA5_c25530 structure-function relationships. Cryo-electron tomography combined with subtomogram averaging could provide insights into the protein's native membrane organization and potential interactions with other membrane components. This technique allows visualization of proteins in their cellular context without extraction. Integrative structural biology approaches that combine data from multiple experimental sources (cryo-EM, crosslinking-mass spectrometry, SAXS) with computational modeling could generate more accurate structural models than any single method alone. Advanced membrane protein mass spectrometry techniques, including native mass spectrometry and hydrogen-deuterium exchange mass spectrometry, can provide information about protein dynamics, ligand binding, and conformational changes under different conditions. Single-molecule techniques such as high-speed atomic force microscopy (HS-AFM) and single-molecule FRET could reveal dynamic conformational changes during function. For functional characterization, the development of specialized proteoliposome-based assays incorporating fluorescent sensors might detect subtle transport or signaling activities. Microfluidic platforms coupled with real-time imaging could monitor the protein's behavior under precisely controlled environmental gradients, mimicking conditions experienced by O. carboxidovorans during metabolic transitions. Finally, genome-wide CRISPR screens in engineered O. carboxidovorans could identify genetic interactions with OCAR_5428/OCA5_c25530, providing functional context through genetic networks .

How can computational approaches enhance experimental research on OCAR_5428/OCA5_c25530?

Computational approaches can significantly enhance experimental research on OCAR_5428/OCA5_c25530 through multiple complementary strategies. Advanced protein structure prediction methods, particularly those utilizing deep learning such as AlphaFold2, can generate high-confidence structural models of the protein that guide experimental design for mutagenesis studies and functional characterization. These predictions are especially valuable for membrane proteins like OCAR_5428/OCA5_c25530, which are challenging to study experimentally. Molecular dynamics simulations can model the protein's behavior within a lipid bilayer environment, providing insights into conformational dynamics, potential binding sites, and interactions with lipids or other membrane components that might be difficult to capture experimentally. For functional prediction, sequence-based comparative genomics across related bacterial species can identify conserved residues and co-evolving networks of amino acids, suggesting functionally important regions. Machine learning approaches integrating multi-omics data (transcriptomics, proteomics, metabolomics) from O. carboxidovorans grown under various conditions can potentially predict the protein's involvement in specific cellular processes through guilt-by-association principles . Systems biology modeling of O. carboxidovorans metabolism can identify potential roles of OCAR_5428/OCA5_c25530 by simulating the effects of its absence or overexpression on metabolic flux distributions. Finally, network pharmacology approaches can predict small molecules that might interact with the protein, providing potential tools for experimental manipulation of its function. These computational methods generate testable hypotheses that focus experimental efforts and accelerate the characterization of this poorly understood membrane protein .

What insights can be gained by examining OCAR_5428/OCA5_c25530 in the context of O. carboxidovorans' evolution and ecological niche?

Examining OCAR_5428/OCA5_c25530 in the context of O. carboxidovorans' evolution and ecological niche provides valuable insights into potential specialized functions of this membrane protein. O. carboxidovorans has evolved the remarkable ability to grow chemolithoautotrophically by utilizing CO and H₂ for energy generation and CO₂ fixation, allowing it to occupy ecological niches where these gases are available . This metabolic versatility is encoded primarily on a megaplasmid (pHCG3) containing genes for CO metabolism, H₂ utilization, and the Calvin-Benson-Bassham cycle for CO₂ fixation . While OCAR_5428/OCA5_c25530 appears to be chromosomally encoded rather than on this megaplasmid, it may still play a supporting role in the organism's metabolic adaptability. The observed changes in membrane fatty acid composition between heterotrophic and autotrophic growth conditions suggest that membrane remodeling is a significant aspect of metabolic adaptation in O. carboxidovorans . As a membrane protein, OCAR_5428/OCA5_c25530 could potentially contribute to this adaptation process. The organism's taxonomic classification within Alphaproteobacteria and specifically the Nitrobacteraceae family places it among groups known for metabolic diversity and adaptability to specialized niches. Examining the distribution and conservation of OCAR_5428/OCA5_c25530 homologs across related species with varying metabolic capabilities could reveal whether this protein is associated with specific metabolic traits that contribute to O. carboxidovorans' unique ecological adaptations .

How does the study of OCAR_5428/OCA5_c25530 contribute to broader understanding of membrane protein biology in chemolithoautotrophic bacteria?

The study of OCAR_5428/OCA5_c25530 contributes significantly to the broader understanding of membrane protein biology in chemolithoautotrophic bacteria through several important dimensions. First, it provides insights into how membrane proteins participate in the complex metabolic switching between heterotrophic and autotrophic growth modes, a characteristic feature of metabolically versatile bacteria like O. carboxidovorans . Proteome and membrane fatty acid analyses have shown that O. carboxidovorans undergoes substantial membrane remodeling during this metabolic shift, suggesting specialized roles for membrane proteins in facilitating these adaptations . Second, as a member of the UPF0060 family, characterization of OCAR_5428/OCA5_c25530 would help illuminate the functions of this uncharacterized protein family across bacterial species. Third, studying this protein in the context of syngas utilization could reveal specific adaptations that allow chemolithoautotrophic bacteria to efficiently capture and utilize gaseous substrates, potentially identifying unique transport mechanisms or membrane organizations that facilitate gas exchange . Fourth, the establishment of genetic manipulation techniques for O. carboxidovorans enables systematic structure-function studies of OCAR_5428/OCA5_c25530, potentially revealing how membrane proteins evolve to support specialized metabolic capabilities . Finally, membrane proteins like OCAR_5428/OCA5_c25530 may play crucial roles in oxidative homeostasis, which is particularly important for aerobic chemolithoautotrophs that must balance oxygen utilization for energy generation with the prevention of oxidative damage . Understanding these mechanisms could reveal general principles of redox management at the membrane interface that apply across diverse bacterial species .

How should researchers design experiments to investigate the regulation of OCAR_5428/OCA5_c25530 expression under different growth conditions?

Designing experiments to investigate OCAR_5428/OCA5_c25530 regulation under different growth conditions requires a comprehensive approach that captures transcriptional, translational, and post-translational regulatory mechanisms. Researchers should establish a matrix of growth conditions comparing heterotrophic growth (using acetate or other organic carbon sources) with autotrophic growth (using various combinations of CO, CO₂, and H₂) at different growth phases (lag, exponential, stationary) . For transcriptional regulation, employ quantitative RT-PCR to measure OCAR_5428/OCA5_c25530 mRNA levels across these conditions, and complement this with RNA-Seq for genome-wide context. Promoter analysis using reporter gene fusions (like lacZ or GFP) can identify regulatory elements controlling expression. For translational regulation, implement ribosome profiling to assess translation efficiency alongside proteomics to measure protein abundance. Western blotting with anti-His antibodies (for tagged versions) or custom antibodies against the native protein can track protein levels with greater sensitivity. To identify potential transcription factors regulating OCAR_5428/OCA5_c25530, perform chromatin immunoprecipitation followed by sequencing (ChIP-seq) or DNA affinity purification followed by mass spectrometry (DAP-MS). For environmental sensing mechanisms, systematically vary parameters like oxygen tension, pH, temperature, and nutrient limitation while monitoring expression. Genetic approaches including creating reporter strains with fluorescent protein fusions can enable real-time monitoring of expression dynamics during growth condition transitions. Additionally, implement genome-wide transposon mutagenesis screens to identify genes that influence OCAR_5428/OCA5_c25530 expression under specific conditions .

What controls and validation steps are essential when studying protein-protein interactions involving OCAR_5428/OCA5_c25530?

When studying protein-protein interactions involving OCAR_5428/OCA5_c25530, essential controls and validation steps must be implemented to ensure reliable results. First, include appropriate negative controls in all interaction experiments, such as an unrelated membrane protein of similar size and hydrophobicity, or a mutant version of OCAR_5428/OCA5_c25530 with disrupted interaction interfaces. For pull-down experiments, include beads-only controls and non-specific binding controls (with untagged proteins) to identify false positives due to non-specific matrix binding. When using tagged versions of the protein, verify that the tag doesn't alter localization or function through complementation experiments in deletion strains. Validate interactions using reciprocal pull-downs, where each partner is used as bait in separate experiments. For all identified interactions, confirm their specificity through competition experiments with unlabeled protein and demonstrate specificity by showing that mutations in predicted interaction interfaces disrupt binding. Employ multiple, orthogonal interaction detection methods with different underlying principles (e.g., co-immunoprecipitation, FRET, split-GFP complementation, crosslinking-MS) to validate interactions. Quantify interaction strengths using methods like surface plasmon resonance, isothermal titration calorimetry, or microscale thermophoresis to distinguish high-affinity specific interactions from low-affinity non-specific ones. For physiological relevance, demonstrate that interactions occur in the native membrane environment using approaches like in vivo crosslinking or proximity labeling, and correlate interaction dynamics with functional outcomes under different growth conditions (heterotrophic vs. autotrophic) .

What experimental design would best elucidate the role of OCAR_5428/OCA5_c25530 in membrane adaptation during metabolic switching?

To elucidate the role of OCAR_5428/OCA5_c25530 in membrane adaptation during metabolic switching, an integrated experimental design combining genetic, biochemical, and biophysical approaches is optimal. First, create a clean deletion mutant of OCAR_5428/OCA5_c25530 using the established gene deletion protocols for O. carboxidovorans , and complement this strain with wild-type and site-directed mutant versions to confirm phenotypic restoration. Compare growth characteristics of wild-type and mutant strains during heterotrophic growth, autotrophic growth, and during transitions between these metabolic modes, with particular attention to lag phases during adaptation periods. Perform detailed membrane compositional analysis using lipidomics and fatty acid methyl ester (FAME) analysis to compare membrane composition changes between wild-type and mutant strains during metabolic switching . Employ membrane biophysical techniques including fluorescence anisotropy, differential scanning calorimetry, and atomic force microscopy to assess membrane fluidity, phase transitions, and nanomechanical properties during adaptation. Conduct comprehensive proteomics of membrane fractions from wild-type and mutant strains to identify other membrane proteins whose abundance or modification state changes in response to OCAR_5428/OCA5_c25530 deletion. For functional assessment, measure membrane permeability to relevant substrates (CO, CO₂, H₂) and membrane potential during metabolic transitions. Implement live cell imaging with fluorescent membrane probes to visualize dynamic membrane reorganization during adaptation. Finally, perform metabolic flux analysis comparing wild-type and mutant strains to determine how altered membrane properties impact global metabolic reorganization during switching between heterotrophic and autotrophic metabolism .