Recombinant Olimarabidopsis pumila Apocytochrome f (petA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us for preferential development.
Synonyms
petA; Cytochrome f
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
36-320
Protein Length
Full Length of Mature Protein
Species
Olimarabidopsis pumila (Dwarf rocket) (Arabidopsis griffithiana)
Target Names
petA
Target Protein Sequence
YPIFAQQNYENPREATGRIVCANCHLANKPVDIEVPQTVLPDTVFEAVVKIPYDMQLKQV LANGKKGALNVGAVLILPEGFELAPPDRISPEIKEKIGTLSFQNYRPNKKNILVIGPVPG QKYSEITFPILAPDPATNKDVHFLKYPIYVGGNRGRGQIYPDGSKSNNTVYNATTGGIIS KILRKEKGGYEITIVDASNGREVIDIIPRGLELLVSEGESIKLDQPLTSNPNVGGFGQGD AEIVLQDPLRVQGLLFFLGSVVLAQIFLVLKKKQFEKVQLSEMNF
Uniprot No.

Target Background

Function
A component of the cytochrome b6-f complex, mediating electron transfer between photosystem II (PSII) and photosystem I (PSI), cyclic electron flow around PSI, and state transitions.
Protein Families
Cytochrome f family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Single-pass membrane protein.

Q&A

What is Apocytochrome f and what functional role does it serve in Olimarabidopsis pumila?

Apocytochrome f represents the precursor form of cytochrome f, a critical c-type cytochrome encoded by the chloroplast petA gene in Olimarabidopsis pumila. The protein is synthesized initially as a precursor with a lumen-targeting peptide that facilitates the translocation of most of the apoprotein through the thylakoid membrane . This precursor undergoes maturation on the luminal side of the thylakoid membrane through two key processes: covalent heme attachment and cleavage of the targeting peptide, thereby transforming into the functional holocytochrome f . The mature cytochrome f remains membrane-associated through a C-terminal-located α-helix, where it serves as an essential component of the cytochrome b6f complex within the photosynthetic electron transport chain . In Olimarabidopsis pumila specifically, this protein contributes to the plant's enhanced photosynthetic efficiency under high light conditions, which represents an evolutionary adaptation to harsh environmental conditions .

How does the structure of recombinant Olimarabidopsis pumila Apocytochrome f compare to homologous proteins in other species?

Recombinant Olimarabidopsis pumila Apocytochrome f consists of 285 amino acids (positions 36-320 of the full protein), with a comprehensive sequence including conserved domains critical for electron transport functionality . Analysis of its primary structure reveals several key functional regions including heme-binding motifs and membrane anchor domains that are highly conserved across photosynthetic organisms . The protein contains characteristic cysteine residues essential for covalent heme attachment, particularly within the conserved CXXCH motif typical of c-type cytochromes . Comparative structural analysis between Olimarabidopsis pumila Apocytochrome f and that of other Brassicaceae members shows high sequence conservation in catalytic regions while displaying species-specific variations in peripheral domains, likely reflecting adaptations to different ecological niches . The recombinant protein, when expressed with an N-terminal His-tag in E. coli systems, maintains the structural integrity of these functional domains while providing additional benefits for purification and experimental manipulation .

What protocols are most effective for purification and reconstitution of recombinant Apocytochrome f for structural and functional studies?

Purification of recombinant His-tagged Olimarabidopsis pumila Apocytochrome f requires a systematic approach beginning with optimization of bacterial cell lysis conditions to prevent protein degradation . The recommended purification protocol involves initial capture using nickel or cobalt-based affinity chromatography under native conditions with imidazole gradients optimized to minimize non-specific binding while maximizing target protein yield . For high-purity preparations required for structural studies, researchers should implement secondary purification steps such as ion-exchange chromatography or size exclusion chromatography to achieve homogeneity exceeding 95% . The purified protein is typically supplied as a lyophilized powder and requires careful reconstitution in an appropriate buffer system . For optimal results, researchers should reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL, with the addition of 5-50% glycerol (with 50% being standard) for long-term storage stability . Critical quality control assessments should include verification of structural integrity via circular dichroism spectroscopy and functional analysis through electron transfer assays to confirm that the recombinant protein retains native-like properties.

How can researchers effectively study salt stress responses mediated by Apocytochrome f in Olimarabidopsis pumila?

To investigate salt stress responses involving Apocytochrome f in Olimarabidopsis pumila, researchers should implement a comprehensive experimental approach combining both in vivo and in vitro methodologies . A robust experimental design begins with carefully controlled growth conditions where plants are maintained under standard parameters (22°C, 16-hour photoperiod, light intensity of 200 μmol m⁻² s⁻¹) before exposure to salt stress treatments . The recommended protocol for salt shock involves treating 4-week-old plants with 0.5× MS nutrient solution supplemented with 500 mM NaCl, followed by leaf tissue collection at strategic time points (0, 0.5, 3, 9, 14, and 24 hours) to capture the complete expression profile dynamics . RNA extraction should be performed immediately from flash-frozen tissue samples to preserve transcript integrity, followed by quantitative RT-PCR analysis using petA-specific primers designed from the Olimarabidopsis pumila sequence . For protein-level analyses, researchers should complement transcriptomic approaches with quantitative immunoblotting using antibodies specific to Apocytochrome f, noting that visible wilting typically begins after 16-18 hours of high-salt exposure, suggesting that critical regulatory events occur prior to this timepoint . Comparative analyses between Olimarabidopsis pumila and less salt-tolerant relatives such as Arabidopsis thaliana can provide particularly valuable insights into adaptive mechanisms conferred by structural or regulatory differences in the petA gene and its protein product.

What analytical techniques are most informative for characterizing post-translational modifications of Apocytochrome f?

Comprehensive characterization of post-translational modifications (PTMs) in Olimarabidopsis pumila Apocytochrome f requires a multi-technique analytical approach focusing on the critical conversion from apocytochrome to holocytochrome forms . Mass spectrometry represents the primary analytical platform, with liquid chromatography coupled to tandem mass spectrometry (LC-MS/MS) providing the highest resolution for mapping modification sites following enzymatic digestion with proteases such as trypsin or chymotrypsin . For detailed characterization of heme attachment, researchers should employ targeted precursor ion scanning to identify diagnostic fragments derived from the covalent heme-peptide linkage . Advanced techniques for analyzing the thioether bonds between heme and protein include electron capture dissociation (ECD) or electron transfer dissociation (ETD), which preserve labile PTMs while generating informative fragmentation patterns . Complementary approaches include UV-visible spectroscopy to confirm heme incorporation through characteristic absorption maxima and resonance Raman spectroscopy to analyze the coordination environment of the heme iron . For studying the membrane-anchoring domain and its interactions, researchers should consider hydrogen-deuterium exchange mass spectrometry (HDX-MS) to assess solvent accessibility and potential conformational changes associated with membrane integration . Cross-validation using multiple techniques is essential for comprehensive PTM characterization, as each method provides unique and complementary structural information.

How should researchers design site-directed mutagenesis experiments to investigate structure-function relationships in Olimarabidopsis pumila Apocytochrome f?

Designing effective site-directed mutagenesis experiments for Olimarabidopsis pumila Apocytochrome f requires strategic planning based on sequence conservation analysis and structural insights . Researchers should begin by conducting multiple sequence alignments of Apocytochrome f across diverse photosynthetic organisms to identify both highly conserved residues and those unique to Olimarabidopsis pumila, which may confer its enhanced stress tolerance properties . Priority targets for mutagenesis include the CXXCH heme-binding motif, where substitutions of the conserved cysteine residues can directly assess the importance of covalent heme attachment to protein function and stability . The C-terminal membrane anchoring domain represents another critical target, where systematic alterations in the hydrophobic α-helix can elucidate the role of membrane association in protein stability and electron transfer dynamics . For mutagenesis protocols, researchers should utilize PCR-based approaches with the recombinant expression plasmids as templates, ensuring proper primer design with 15-20 nucleotide matches on either side of the desired mutation . Following mutagenesis and sequence verification, comparative functional analysis of wild-type and mutant proteins requires consistent expression and purification protocols to ensure that observed differences result from the introduced mutations rather than preparation artifacts . Comprehensive characterization should include stability assessments through thermal denaturation, electron transfer kinetics using laser flash photolysis, and structural analyses via spectroscopic methods to fully understand the impact of each mutation on protein function.

What controls and validation methods are essential when studying protein-protein interactions involving Apocytochrome f in thylakoid complexes?

Investigating protein-protein interactions involving Olimarabidopsis pumila Apocytochrome f requires rigorous experimental design with appropriate controls and validation through multiple complementary techniques . Researchers should implement co-immunoprecipitation (co-IP) assays using antibodies specific to Apocytochrome f, with careful attention to extraction conditions that preserve native membrane protein complexes using mild detergents such as n-dodecyl-β-D-maltoside (DDM) or digitonin . Essential negative controls include parallel experiments with non-specific antibodies of the same isotype and immunoprecipitation from samples lacking the target protein or expressing mutant versions with disrupted interaction domains . Bimolecular fluorescence complementation (BiFC) provides an alternative approach for visualizing interactions in vivo, requiring careful design of fusion constructs that place fluorescent protein fragments at positions that do not interfere with native protein folding or function . Cross-validation through multiple techniques is crucial, with pull-down assays using recombinant tagged proteins serving as a complementary in vitro approach to verify direct interactions . Surface plasmon resonance (SPR) or isothermal titration calorimetry (ITC) provides quantitative binding parameters including association/dissociation constants, which should be determined under varying pH and salt concentrations to understand how environmental stressors affect interaction dynamics . For the most comprehensive analysis, researchers should complement these biochemical approaches with structural studies such as cryo-electron microscopy of isolated complexes or hydrogen-deuterium exchange mass spectrometry to map interaction interfaces at the residue level.

What are the optimal conditions for conducting comparative expression studies of petA in stress-tolerant Olimarabidopsis pumila versus model organisms?

Designing robust comparative expression studies of the petA gene between Olimarabidopsis pumila and model organisms such as Arabidopsis thaliana requires careful standardization of experimental conditions to isolate species-specific responses from experimental variables . Researchers should establish parallel growth conditions with synchronized developmental stages, using growth chambers programmed to maintain identical temperature (22°C), photoperiod (16h light/8h dark), and light intensity (200 μmol m⁻² s⁻¹) . For salt stress experiments, seedlings should be cultivated for exactly 7 days on half-strength Murashige-Skoog media before transplantation to soil mixtures with identical composition (1:1 peat soil and vermiculite), followed by acclimation for 3 weeks prior to treatment . The salt stress application protocol should standardize concentration (500 mM NaCl), application method (irrigation with supplemented 0.5× MS solution), and precise timing of tissue collection across species . RNA isolation procedures must be identical between species, with quality assessment through both spectrophotometric ratios and gel electrophoresis to ensure comparable RNA integrity numbers (RIN > 8) . For qRT-PCR analysis, researchers must carefully validate reference genes that show stable expression across both species under all treatment conditions, with normalization based on multiple reference genes rather than a single housekeeping gene . Statistical analysis should implement two-way ANOVA to distinguish species-specific effects from treatment effects and their interactions, with appropriate post-hoc tests to identify significant differences at each time point . This rigorous approach ensures that observed differences in petA expression patterns can be confidently attributed to species-specific regulatory mechanisms rather than experimental artifacts.

How can researchers effectively compare sequence and structural data between Apocytochrome f variants from different photosynthetic organisms?

Comparative analysis of Apocytochrome f sequences and structures across diverse photosynthetic organisms requires integration of bioinformatic approaches with structural biology techniques . Researchers should begin by constructing multiple sequence alignments using algorithms specifically optimized for membrane proteins, such as MAFFT with the L-INS-i strategy, which accounts for potentially lengthy insertions between conserved domains . These alignments should be visualized using tools that highlight physicochemical properties rather than simple identity/similarity, as functional conservation often involves substitutions that maintain charge or hydrophobicity rather than exact amino acid identity . For phylogenetic analysis, researchers should employ maximum likelihood methods with appropriate substitution models selected through statistical testing (e.g., ProtTest), with tree robustness evaluated through bootstrap analysis (minimum 1000 replicates) . Structural comparisons require homology modeling using Olimarabidopsis pumila Apocytochrome f sequence against available crystal structures of homologous proteins, with model quality assessed through metrics such as QMEAN and Ramachandran plot analysis . Comparative analysis should focus on four key aspects: conservation of heme-binding sites, surface electrostatic potential differences that may influence protein-protein interactions, membrane-integration domains, and species-specific insertions or deletions that may confer adaptive advantages . Researchers should supplement computational analyses with experimental validation of key structural predictions through targeted mutagenesis or limited proteolysis coupled with mass spectrometry to confirm accessibility of predicted surface regions.

What statistical approaches best detect significant changes in Apocytochrome f expression under variable environmental conditions?

Analyzing Apocytochrome f expression changes under varying environmental conditions requires sophisticated statistical approaches that address both temporal dynamics and potential non-linear responses . Researchers should implement time-series analysis methods rather than simple endpoint comparisons, using repeated measures ANOVA with appropriate post-hoc tests when data meet parametric assumptions . For datasets with non-normal distributions, non-parametric alternatives such as Friedman's test followed by Dunn's multiple comparison test should be employed . When analyzing qRT-PCR data specifically, researchers must calculate amplification efficiencies for each primer set and incorporate these values into relative quantification methods such as the Pfaffl method rather than assuming perfect doubling with each cycle . For complex experimental designs investigating multiple factors simultaneously (e.g., temperature, light intensity, and salinity), mixed-effects models provide superior statistical power by accounting for both fixed and random effects, particularly when including biological replicates as random factors . Time-course expression data should be visualized through heat maps with hierarchical clustering to identify co-regulated genes, supplemented with principal component analysis to detect major patterns of variation across experimental conditions . For integrating transcriptomic data with physiological measurements, canonical correlation analysis enables researchers to identify relationships between gene expression patterns and functional plant responses such as photosynthetic efficiency or growth parameters . Statistical significance should be evaluated with appropriate multiple testing corrections such as Benjamini-Hochberg to control false discovery rates when analyzing large datasets.

What approaches can resolve contradictory findings regarding post-translational regulation of Apocytochrome f across different experimental systems?

Resolving contradictory findings regarding post-translational regulation of Apocytochrome f requires systematic investigation of methodological variables that may influence experimental outcomes . Researchers should implement a meta-analytical approach beginning with comprehensive literature review and standardized extraction of methodological details including protein expression systems, purification methods, buffer compositions, and analytical techniques . For contradictory results from different expression systems, side-by-side comparisons using identical analytical methods should be conducted with proteins expressed in bacterial (E. coli), algal (Chlamydomonas), and higher plant systems to determine whether host-specific factors influence post-translational modifications . When investigating discrepancies in membrane integration or protein-protein interactions, researchers should carefully evaluate detergent effects by comparing multiple solubilization strategies ranging from harsh (SDS) to mild (digitonin) detergents, as extraction methods can significantly alter native protein conformations and interaction networks . For contradictory findings regarding regulatory phosphorylation sites, researchers should implement multi-enzyme digestion strategies coupled with enrichment techniques such as titanium dioxide chromatography before mass spectrometric analysis to maximize phosphopeptide coverage . Collaboration between laboratories reporting contradictory results provides the most direct path to resolution, implementing standardized protocols with sample sharing and blinded analysis to identify sources of variation . When inconsistencies persist despite methodological standardization, researchers should consider biological explanations such as genetic background differences or environmental conditions during growth that may genuinely influence post-translational regulation mechanisms.

How can structural information about Olimarabidopsis pumila Apocytochrome f inform protein engineering for enhanced photosynthetic efficiency?

Leveraging structural insights about Olimarabidopsis pumila Apocytochrome f for protein engineering represents a frontier approach for enhancing photosynthetic efficiency in crop plants . Researchers should begin by generating high-resolution structural models using the Olimarabidopsis pumila sequence, incorporating data from homologous crystal structures while focusing on unique features that may contribute to the enhanced photosynthetic performance observed in this stress-adapted species . Comparative analysis with Arabidopsis thaliana cytochrome f should highlight amino acid differences at the electron transfer interface with plastocyanin, where even subtle alterations in surface charge distribution or hydrophobicity can significantly influence electron transfer kinetics . Protein engineering strategies should target three priority areas: (1) optimizing the redox potential through modifications of the heme microenvironment, (2) enhancing protein stability under heat or high light conditions through strategic introduction of stabilizing interactions, and (3) fine-tuning protein-protein interaction surfaces to increase electron transfer efficiency . Computational approaches including molecular dynamics simulations under varying temperature and pH conditions can predict the impact of designed mutations before experimental verification . For experimental validation, engineered variants should be assessed through in vitro electron transfer kinetics measurements using laser flash photolysis, followed by integration into model systems such as Chlamydomonas reinhardtii or tobacco chloroplasts to evaluate photosynthetic performance under controlled environmental conditions . Success metrics should include not only enhanced electron transport rates but also improved resilience to environmental stressors and ultimately increased biomass production under field-relevant conditions.

What methodologies can integrate transcriptomic, proteomic, and functional data to build comprehensive models of Apocytochrome f regulation under stress?

Developing integrated models of Apocytochrome f regulation under stress conditions requires sophisticated multi-omics approaches that capture dynamics at multiple biological levels . Researchers should implement a coordinated experimental design where samples for transcriptomic, proteomic, and physiological analyses are collected from the same biological material at synchronized time points following stress application . RNA-sequencing provides comprehensive transcriptional profiles, with particular attention to both the chloroplast-encoded petA gene and nuclear genes encoding factors involved in its regulation, processing, and assembly . For proteomics, sequential extraction protocols should be optimized to effectively solubilize membrane proteins, followed by both discovery-based and targeted quantitative approaches focusing on the cytochrome b6f complex components and their interacting partners . Functional measurements including chlorophyll fluorescence parameters, P700 oxidation kinetics, and photosynthetic electron transport rates should be performed in parallel to establish direct links between molecular changes and physiological outcomes . Data integration should employ multivariate statistical methods such as partial least squares discriminant analysis to identify correlations between molecular markers and functional parameters . Network modeling approaches including weighted gene co-expression network analysis (WGCNA) can identify modules of co-regulated genes and proteins, while Bayesian network analysis can infer potential causal relationships among components . Time-series analysis using dynamic Bayesian networks is particularly valuable for capturing the temporal sequence of regulatory events from transcriptional changes through protein accumulation to functional impacts . These integrated models should be iteratively refined through targeted experimental validation of key predictions, ultimately generating testable hypotheses about critical regulatory nodes that could be manipulated to enhance stress resilience.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.