Recombinant Olimarabidopsis pumila Chloroplast envelope membrane protein (cemA)

Shipped with Ice Packs
In Stock

Description

Function and Significance

The chloroplast envelope membranes contain a diverse set of proteins involved in various functions :

  • Ion and metabolite transport

  • Protein import machinery

  • Chloroplast lipid metabolism

About one-third of the proteins identified in chloroplast envelope membranes have no known function, highlighting the complexity and the need for further research in this area . Proteomic studies have identified and cataloged many proteins, providing insights into chloroplast envelope metabolism at the molecular level .

Identification and Characterization

Proteomic analyses, including liquid chromatography tandem mass spectrometry, have been instrumental in identifying proteins located in the chloroplast envelope . These methods involve:

  1. Preparing highly purified envelope membranes from Arabidopsis chloroplasts .

  2. Extracting envelope proteins using different methods, such as chloroform/methanol extraction and alkaline or saline treatments, to retrieve as many proteins as possible .

  3. Analyzing envelope membrane subfractions using liquid chromatography tandem mass spectrometry .

OEP80 and Related Proteins

OEP80 (Outer Envelope Protein 80) is an Omp85-related protein found in the outer membrane of chloroplasts . Omp85 proteins are essential for viability in Arabidopsis . Arabidopsis chloroplasts have two distinct types of Omp85-related proteins: Toc75 (Translocon at the outer envelope membrane of chloroplasts, 75 kD) and OEP80 . While Toc75 functions as a preprotein translocation channel during chloroplast import, the role of OEP80 is less clear .

FTSH11 Protease

FTSH11 is a membrane-bound, ATP-dependent metalloprotease located in the chloroplast envelope . Studies using transgenic plants have confirmed its location in the chloroplast envelope through immunoblot analysis . FTSH11 may also be involved in degrading excess copies of proteins like TIC40, especially under high-temperature conditions .

Proteomic Studies and Hidden Components

Advanced mass spectrometry techniques have been used to define the proteome of the chloroplast envelope, identifying previously undetected envelope proteins . These studies often involve comparing the proteomes of total leaf extracts and purified chloroplast envelope fractions to identify genuine envelope components .

Experimental Procedures

Purification of chloroplast envelopes often involves these steps :

  1. Preparing total leaf extracts from Arabidopsis thaliana plants .

  2. Purifying intact chloroplasts using isopyknic centrifugation with Percoll gradients .

  3. Lysing purified chloroplasts in hypotonic medium containing protease inhibitors .

  4. Purifying the envelope from the lysate by centrifugation on sucrose gradients .

  5. Recovering envelope proteins by aspirating the yellow band from the sucrose gradient .

  6. Diluting and pelleting the recovered envelope proteins by ultracentrifugation .

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes if you have a specific requirement. We will fulfill your request to the best of our ability.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and agreed upon in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C. Lyophilized formulations typically have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Repeated freeze-thaw cycles should be avoided.
Tag Info
The tag type is determined during the manufacturing process.
The specific tag type will be determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
cemA; ycf10; Chloroplast envelope membrane protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-229
Protein Length
full length protein
Species
Olimarabidopsis pumila (Dwarf rocket) (Arabidopsis griffithiana)
Target Names
cemA
Target Protein Sequence
MAKKKAFIPFFYFTSIVFLPWLISLCCNKSLKTWITNWWNTRQCETFLNDIQEKSVLEKF IQLEELFQLDEMIKEYPETDLQQFRLGIHKETIQFIKIHNEYRIHTILHFSTNLISFVIL SGYSFWGKEKLFILNSWVQEFLYNLSDTIKAFSILLLTDLCIGFHSPHGWELMIGYIYKD FGFAHYEQILSGLVSTFPVILDTIFKYWIFRYLNRVSPSLVVIYHAIND
Uniprot No.

Target Background

Function
This protein may be involved in proton extrusion and indirectly promotes efficient inorganic carbon uptake into chloroplasts.
Protein Families
Cema family
Subcellular Location
Plastid, chloroplast inner membrane; Multi-pass membrane protein.

Q&A

How is Olimarabidopsis pumila different from the model plant Arabidopsis thaliana in terms of stress adaptation?

  • Higher photosynthetic efficiency

  • Higher propagation rate

  • Higher salinity tolerance

These characteristics make O. pumila an excellent candidate plant system for gene mining related to environmental adaptation and salt tolerance mechanisms . While not classified as a true halophyte like salt cress (Thellungiella halophila), O. pumila exhibits better salt tolerance than the glycophyte A. thaliana, despite lacking specialized salt glands . This intermediate salt tolerance capability provides valuable insights into adaptive mechanisms within the Brassicaceae family.

What experimental evidence exists for cemA's role in chloroplast function?

Current experimental evidence suggests that cemA contributes to:

  • Chloroplast envelope integrity: As a membrane protein, cemA appears to maintain structural integrity of the envelope membrane system.

  • Potential role in salt tolerance: Expression studies during salt stress conditions show variation in transcription levels of several chloroplast proteins including envelope membrane proteins, suggesting their involvement in stress response mechanisms .

  • Energy metabolism: Based on its localization and the observed altered photosynthetic efficiency in plants with different cemA expression levels, this protein likely plays a role in energy-related processes within chloroplasts.

What are the optimal methods for expressing and purifying recombinant Olimarabidopsis pumila cemA protein?

The expression and purification of recombinant O. pumila cemA requires specialized approaches due to its membrane-associated nature:

Recommended Expression System Protocol:

  • Vector Selection: Expression vectors with strong, inducible promoters (e.g., pET series) containing appropriate tags for purification.

  • Host Organism: E. coli strains optimized for membrane protein expression (e.g., C41(DE3), C43(DE3), or Rosetta-gami).

  • Expression Conditions:

    • Growth at lower temperatures (16-20°C) after induction

    • Lower IPTG concentrations (0.1-0.5 mM)

    • Extended expression periods (16-24 hours)

    • Addition of membrane-stabilizing agents

  • Solubilization and Purification:

    • Careful membrane isolation

    • Gentle solubilization using mild detergents (DDM, LDAO)

    • Affinity chromatography using the tag system

    • Size exclusion chromatography for final purification

  • Storage Conditions:

    • Store at -20°C for regular use or -80°C for extended storage

    • Use a Tris-based buffer with 50% glycerol to maintain protein stability

    • Avoid repeated freeze-thaw cycles as this can compromise structural integrity

How can researchers effectively analyze cemA structure-function relationships?

Analysis of cemA structure-function relationships requires multiple complementary approaches:

  • Computational Structure Prediction:

    • Homology modeling based on related proteins

    • Ab initio modeling for unique regions

    • Molecular dynamics simulations to assess stability and interactions

  • Experimental Structure Determination:

    • X-ray crystallography (challenging for membrane proteins)

    • Cryo-electron microscopy for native-like structural information

    • NMR spectroscopy for dynamic structural elements

  • Functional Assays:

    • Site-directed mutagenesis of conserved residues

    • Domain-swapping experiments

    • Protein-protein interaction assays (Y2H, co-IP, BiFC)

    • Electrophysiological measurements (similar to those performed for Omp85 family proteins in Arabidopsis thaliana)

  • Comparative Analysis:

    • Compare with other chloroplast envelope proteins such as P39 in A. thaliana, which forms a pore with Omp85 family protein characteristics

    • Analyze distinctions in the barrel regions that may relate to function

How does cemA expression change under salt stress conditions?

Based on studies of O. pumila response to high salinity conditions:

  • Temporal Expression Pattern:
    Many chloroplast proteins show dynamic expression patterns during salt stress. For instance, in similar experiments:

    • V-ATPase expression peaked at 0.5 hours after salt treatment

    • VP1 expression peaked at 3 hours

    • NHX1 expression peaked at 9 hours

    • RD21a transcription peaked at 14 hours

  • Experimental Protocol for cemA Expression Analysis:

    • Treat 4-week-old plants with 0.5 × MS nutrient solution supplemented with 500 mM NaCl

    • Harvest leaves at multiple time points (0, 0.5, 3, 9, 14, and 24 hours)

    • Extract RNA and perform qRT-PCR with cemA-specific primers

    • Normalize expression levels using appropriate reference genes

    • Analyze expression patterns relative to untreated controls

What methodologies are recommended for investigating cemA's role in Olimarabidopsis pumila's enhanced salt tolerance?

To thoroughly investigate cemA's contribution to salt tolerance:

  • Gene Manipulation Approaches:

    • CRISPR/Cas9-mediated gene editing to create cemA knockout or modified lines

    • RNAi-mediated knockdown of cemA expression

    • Overexpression studies to assess enhanced tolerance potential

  • Comparative Genomics Strategy:

    • Compare cemA sequence and expression between O. pumila and A. thaliana

    • Identify unique structural features or regulatory elements

    • Perform complementation studies in A. thaliana with O. pumila cemA

  • Physiological Assessment Protocol:

    • Measure photosynthetic parameters under salinity stress

    • Assess ion compartmentalization and osmotic adjustment

    • Analyze membrane integrity using electrical conductivity measurements

    • Evaluate reactive oxygen species (ROS) production and antioxidant capacity

  • Protein Interaction Network Analysis:

    • Identify interacting partners using co-immunoprecipitation coupled with mass spectrometry

    • Map interactions with known salt stress response components such as SOS pathway proteins

    • Determine if cemA interacts with proteins like NHX1, SOS2, or SOS3 that are present in the O. pumila EST library and known to be involved in salt tolerance mechanisms

How does O. pumila cemA compare structurally and functionally with similar proteins in other species?

A comparative analysis of cemA across different plant species reveals important structural and functional insights:

Table 1: Comparative Features of Chloroplast Envelope Membrane Proteins

FeatureO. pumila cemAA. thaliana cemAOuter Envelope Protein P39 (A. thaliana)
Protein Length229 amino acids~225 amino acidsVaries (focuses on β-barrel region)
Domain StructureTransmembrane regionsTransmembrane regionsβ-barrel without POTRA domains
Membrane LocationChloroplast envelopeChloroplast envelopeChloroplast outer envelope
Structural MotifsTransmembrane helicesTransmembrane helices16-stranded β-barrel with conserved L6 loop
Electrophysiological PropertiesNot fully characterizedNot fully characterizedSimilar to Toc75-V branch of Omp85 family
Salt Stress ResponsePotentially involvedLess responsiveNot specifically characterized for salt response

The P39 protein in A. thaliana, while not directly homologous to cemA, provides comparative insights as both are chloroplast envelope proteins. P39 lacks polypeptide transport-associated (POTRA) domains but contains a complete 16-stranded β-barrel including a highly conserved L6 loop . This structural organization differs from cemA but illustrates the diversity of chloroplast envelope proteins.

What molecular mechanisms might explain how cemA contributes to environmental adaptation?

Several molecular mechanisms potentially explain cemA's role in environmental adaptation:

  • Membrane Permeability Regulation:

    • May function similarly to channel proteins like P39 in A. thaliana, which forms a pore with specific electrophysiological properties

    • Could regulate ion or metabolite transport across the chloroplast envelope

  • Osmotic Balance Maintenance:

    • Might participate in osmotic homeostasis pathways similar to other proteins upregulated during salt stress in O. pumila

    • Could interact with components of osmotic adjustment mechanisms like those involving LEA proteins or dehydrins

  • Signaling Pathway Integration:

    • Potential role in stress signal transduction between chloroplast and nucleus

    • May coordinate with transcription factors identified in the O. pumila EST library (251 transcription factors classified into 42 families)

  • Energy Metabolism Adaptation:

    • Could influence photosynthetic efficiency under stress conditions

    • May contribute to the higher photosynthetic efficiency observed in O. pumila compared to A. thaliana

What challenges are commonly encountered when working with recombinant chloroplast membrane proteins and how can they be addressed?

Researchers working with recombinant chloroplast membrane proteins like cemA face several technical challenges:

  • Low Expression Yields:

    • Problem: Membrane proteins often express poorly in heterologous systems

    • Solution: Use specialized expression strains (C41/C43), optimize codon usage, and employ fusion partners (MBP, SUMO) to enhance solubility

  • Protein Aggregation:

    • Problem: Tendency to form inclusion bodies or aggregate during purification

    • Solution: Express at lower temperatures (16-20°C), use mild detergents (DDM, LDAO) for extraction, and include stabilizing agents like glycerol in buffers

  • Functional Assay Limitations:

    • Problem: Difficult to assess functional activity outside native membrane environment

    • Solution: Reconstitute in liposomes or nanodiscs to create native-like lipid environments for functional studies

  • Structural Instability:

    • Problem: Loss of native conformation during purification

    • Solution: Minimize purification steps, maintain constant detergent concentration above CMC, and stabilize with specific lipids from chloroplast membranes

  • Crystallization Difficulties:

    • Problem: Membrane proteins are notoriously difficult to crystallize

    • Solution: Screen multiple detergents, use lipidic cubic phase (LCP) crystallization, or consider alternative structural methods like cryo-EM

What bioinformatic approaches are most valuable for analyzing cemA sequence and predicting functional domains?

Advanced bioinformatic approaches for cemA analysis include:

  • Transmembrane Topology Prediction:

    • TMHMM, Phobius, and MEMSAT for transmembrane helix identification

    • SignalP and TargetP for targeting sequence prediction

    • PredGPI for potential membrane anchoring regions

  • Evolutionary Analysis:

    • Multiple sequence alignment of cemA across plant species

    • Phylogenetic tree construction to identify evolutionary relationships

    • Calculation of selection pressure (dN/dS ratios) to identify functionally important residues

  • Structural Modeling Workflow:

    • AlphaFold2 or RoseTTAFold for ab initio structure prediction

    • Molecular dynamics simulations in membrane environments

    • Protein-protein docking with known interacting partners

  • Functional Domain Analysis:

    • Conserved Domain Database (CDD) searches

    • PFAM domain identification

    • Structure-based functional inference through comparison with characterized proteins like P39

How can cemA research contribute to understanding plant adaptation to climate change?

Research on cemA and related chloroplast proteins can provide valuable insights into plant adaptation mechanisms relevant to climate change:

  • Stress Tolerance Enhancement:

    • Understanding how O. pumila cemA contributes to salt tolerance could inform strategies for developing crops with improved abiotic stress resistance

    • The higher photosynthetic efficiency associated with O. pumila provides a model for studying photosynthesis optimization under stressed conditions

  • Genetic Resource Utilization:

    • The EST library containing cemA and other stress-related genes (16,014 high-quality ESTs) serves as a valuable genetic resource for crop improvement programs

    • Identification of novel gene functions through comparative genomics between stress-tolerant and sensitive species

  • Systems Biology Integration:

    • Placing cemA within broader signaling and response networks helps understand whole-plant adaptation mechanisms

    • Connection to transcription factor networks (251 TFs identified in the EST library) can reveal regulatory pathways governing adaptation

  • Translational Research Applications:

    • Development of molecular markers for stress tolerance traits

    • Potential targets for genetic engineering to improve crop resilience

What are the most promising directions for future research on O. pumila cemA?

Future research directions that hold particular promise include:

  • Structure-Function Relationship Elucidation:

    • Determination of high-resolution structure using cryo-EM or X-ray crystallography

    • Characterization of electrophysiological properties similar to studies done with P39

    • Identification of critical residues through site-directed mutagenesis

  • Interactome Mapping:

    • Comprehensive identification of protein-protein interactions in different stress conditions

    • Temporal dynamics of interactome changes during stress response

    • Correlation with other known salt tolerance components like SOS pathway proteins

  • Transgenic Studies:

    • Expression of O. pumila cemA in A. thaliana to assess transferability of stress tolerance

    • CRISPR-mediated gene editing to modify key residues and assess functional consequences

    • Creation of synthetic variants with enhanced stress response capabilities

  • Multi-Omics Integration:

    • Correlation of transcriptomic data (from the existing EST library) with proteomic and metabolomic changes

    • Network analysis to identify regulatory hubs controlling multiple stress response pathways

    • Machine learning approaches to predict gene-phenotype relationships in stress adaptation

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.