Recombinant Olimarabidopsis pumila NAD (P)H-quinone oxidoreductase subunit 3, chloroplastic

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
ndhC; NAD(PH-quinone oxidoreductase subunit 3, chloroplastic; NAD(PH dehydrogenase subunit 3; NADH-plastoquinone oxidoreductase subunit 3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-120
Protein Length
full length protein
Species
Olimarabidopsis pumila (Dwarf rocket) (Arabidopsis griffithiana)
Target Names
ndhC
Target Protein Sequence
MFLLYEYDIFWAFLIISSAIPVLAFLISGVLSPIRKGPEKLSSYESGIEPIGDAWLQFRI RYYMFALVFVVFDVETVFLYPWAMSFDVLGVSAFIEALIFVLILILGLVYAWRKGALEWS
Uniprot No.

Target Background

Function
NDH (NAD(P)H-quinone oxidoreductase) shuttles electrons from NAD(P)H to plastoquinone via FMN and iron-sulfur (Fe-S) centers within the photosynthetic electron transport chain, and potentially in a chloroplast respiratory chain. In this species, plastoquinone is believed to be the enzyme's immediate electron acceptor. NDH couples this redox reaction to proton translocation, thereby conserving redox energy as a proton gradient.
Protein Families
Complex I subunit 3 family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the function of NAD(P)H-quinone oxidoreductase in chloroplasts?

NAD(P)H-quinone oxidoreductase functions as a critical enzyme in photosynthetic electron transport within chloroplasts. This enzyme catalyzes the reduction of quinones and other electron acceptors using either NADPH or NADH as electron donors. In chloroplasts, NAD(P)H-quinone oxidoreductase subunits form part of a larger complex involved in cyclic electron flow, which helps balance the ATP/NADPH ratio during photosynthesis. This process is particularly important under stress conditions when linear electron flow may be insufficient to meet cellular energy requirements. The enzyme also contributes to photoprotection mechanisms by preventing over-reduction of the photosynthetic electron transport chain .

What expression systems are recommended for producing recombinant Olimarabidopsis pumila NAD(P)H-quinone oxidoreductase subunits?

Based on established protocols, E. coli expression systems are the preferred method for producing recombinant NAD(P)H-quinone oxidoreductase subunits from Olimarabidopsis pumila. For optimal expression:

  • Clone the full-length coding sequence (similar to the 1-101aa sequence observed in subunit 4L) into a vector containing an N-terminal His-tag for purification purposes .

  • Transform the construct into an E. coli strain optimized for protein expression (BL21(DE3) or similar derivatives).

  • Induce protein expression using IPTG at concentrations between 0.1-1.0 mM when cultures reach OD600 of 0.6-0.8.

  • Harvest cells and lyse using appropriate buffer systems containing protease inhibitors.

  • Purify using nickel nitrilotriacetate affinity chromatography with stepwise elution using imidazole gradients (typically 20-250 mM) .

This approach facilitates the production of soluble, active enzyme suitable for subsequent functional studies.

What are the optimal storage conditions for maintaining activity of recombinant NAD(P)H-quinone oxidoreductase proteins?

Recombinant NAD(P)H-quinone oxidoreductase proteins require specific storage conditions to maintain structural integrity and enzymatic activity:

Storage ParameterRecommended ConditionNotes
Temperature-20°C to -80°C for long-term storageAvoid repeated freeze-thaw cycles
Physical StateLyophilized powder or aliquoted solutionWorking aliquots can be stored at 4°C for up to one week
Buffer CompositionTris/PBS-based buffer with 6% Trehalose, pH 8.0Addition of 5-50% glycerol (final concentration) for frozen storage
ReconstitutionIn deionized sterile water to 0.1-1.0 mg/mLCentrifuge vial briefly before opening

For optimal stability, the addition of glycerol to a final concentration of 50% is recommended when storing in solution form . Repeated freeze-thaw cycles significantly reduce enzyme activity and should be strictly avoided. When working with the protein, small aliquots should be prepared to minimize the need for multiple thaws.

How can researchers design heterodimer expression systems to study subunit interactions in NAD(P)H-quinone oxidoreductase?

To investigate subunit interactions in NAD(P)H-quinone oxidoreductase using heterodimer expression systems, researchers can implement the following methodological approach:

  • Co-expression vector design: Construct a dual expression vector containing:

    • Wild-type subunit with a polyhistidine tag

    • Mutant subunit (e.g., with a point mutation such as His-194→Ala)

    • Different affinity tags on each subunit (His-tag and alternative tag like FLAG or Strep-tag)

  • Purification strategy: Implement a two-step affinity purification protocol:

    • Initial nickel nitrilotriacetate column chromatography with stepwise imidazole elution to separate His-tagged proteins

    • Secondary affinity purification using the alternative tag to isolate pure heterodimers

  • Verification methods:

    • SDS-PAGE to confirm the presence of both subunits

    • Non-denaturing PAGE to verify heterodimer formation

    • Immunoblot analysis using antibodies specific to each subunit

    • Mass spectrometry to confirm subunit identity and stoichiometry

  • Functional assessment:

    • Enzyme kinetics studies using various electron acceptors (two-electron vs. four-electron acceptors)

    • Determination of Km and kcat values for NADPH and NADH with different substrates

    • Comparison of heterodimer kinetics with corresponding homodimers

This approach has successfully demonstrated that NAD(P)H-quinone oxidoreductase subunits function independently with two-electron acceptors but show cooperative behavior with four-electron acceptors, revealing important insights into the functional relationships between subunits in oligomeric proteins .

What methodological approaches are effective for measuring electron transfer kinetics in NAD(P)H-quinone oxidoreductase?

Several sophisticated methodological approaches can be employed to measure electron transfer kinetics in NAD(P)H-quinone oxidoreductase:

  • Fluorescence-based assays:

    • NADPH fluorescence monitoring (excitation 340 nm, emission 460 nm)

    • Time-resolved measurements following dark-to-light transitions

    • Analysis of biphasic kinetics (fast and slow phases) to distinguish different electron transfer events

  • Spectrophotometric methods:

    • Multi-wavelength absorption spectroscopy to track redox changes in different cofactors

    • Stopped-flow techniques for measuring rapid kinetic events

    • Monitoring the reduction of artificial electron acceptors such as 2,6-dichloroindophenol, menadione, or methyl red

  • Polarographic techniques:

    • Oxygen electrode measurements to assess oxygen consumption/production

    • Clark-type electrode systems for real-time monitoring

  • Preparation of high-quality samples:

    • Isolation of intact chloroplasts using Percoll gradient centrifugation

    • Maintenance of 4°C temperature and dark conditions during isolation

    • Resuspension in appropriate buffers (25 mM Hepes-NaOH pH 8.0, 0.33 M sorbitol, 60 mM KCl, 10 mM EDTA, etc.)

  • Data analysis:

    • Fitting of kinetic traces to appropriate models (mono- or bi-exponential)

    • Determination of rate constants for individual electron transfer steps

    • Assessment of the influence of different substrates and inhibitors

These approaches allow researchers to distinguish between direct enzyme regulation and downstream effects on NADPH consumption pathways, providing insights into the complex electron transfer mechanisms in photosynthetic systems .

How do site-directed mutations in conserved residues affect the catalytic efficiency of NAD(P)H-quinone oxidoreductase?

Site-directed mutagenesis studies have revealed critical insights into structure-function relationships in NAD(P)H-quinone oxidoreductase. The effects of key mutations on catalytic parameters include:

Mutation TypeEffect on Kinetic ParametersFunctional Implication
Histidine residues (e.g., His-194→Ala)Dramatic increase in Km for NADPHCritical role in NADPH binding and orientation
Conserved aromatic residuesDecreased kcat values with minimal Km changesInvolvement in electron transfer rather than substrate binding
Membrane-spanning residuesAltered interaction with hydrophobic substratesImportant for positioning within membrane and quinone access
Cysteine residuesSensitivity to thiol-modifying agentsPotential regulatory sites through redox modification

Research methodologies to investigate these effects include:

  • Generation of point mutations using PCR-based site-directed mutagenesis

  • Expression and purification of mutant proteins using affinity chromatography

  • Comprehensive kinetic analysis with multiple substrates:

    • Two-electron acceptors (2,6-dichloroindophenol, menadione)

    • Four-electron acceptors (methyl red)

    • Varied NADPH and NADH concentrations

These studies demonstrate that specific amino acid residues contribute differentially to substrate binding versus catalytic turnover. For example, in heterodimer studies with His-194→Ala mutations, the Km values for NADPH and NADH remained similar to wild-type enzymes, while kcat values were approximately 50% of wild-type with two-electron acceptors, suggesting that subunits can function independently for certain substrates .

What approaches can elucidate the role of NAD(P)H-quinone oxidoreductase in regulating photosynthetic electron flow?

To investigate the regulatory role of NAD(P)H-quinone oxidoreductase in photosynthetic electron flow, researchers can employ the following comprehensive approaches:

  • Genetic manipulation strategies:

    • Generation of knockout/knockdown lines for specific NAD(P)H-quinone oxidoreductase subunits

    • Creation of plants with altered expression levels through overexpression or antisense approaches

    • Development of plants with modified FNR (ferredoxin:NADP+ oxidoreductase) abundance to examine upstream regulation

  • Real-time monitoring techniques:

    • Chlorophyll fluorescence measurements to assess photosystem II quantum yield

    • P700 absorption measurements to monitor photosystem I redox state

    • NADPH fluorescence kinetics to track the fast and slow phases of NADP+ reduction

  • Metabolic analysis:

    • Measurement of Calvin-Benson-Bassham cycle intermediate concentrations

    • Assessment of thioredoxin-mediated regulation of downstream enzymes

    • Analysis of glutathione redox poise as influenced by NAD(P)H-quinone oxidoreductase activity

  • Environmental response studies:

    • Dark-to-light transition experiments to evaluate activation kinetics

    • Stress conditions (temperature, light intensity, CO2 levels) to assess regulatory flexibility

    • Inhibitor studies to dissect specific components of the electron transport chain

These methodologies have revealed that NAD(P)H-quinone oxidoreductase contributes to the regulation of photosynthetic electron flow through interactions with other enzymes such as glyceraldehyde 3-phosphate dehydrogenase (GAPDH) and NADPH malate dehydrogenase (NADP-MDH), which are regulated by thioredoxin-mediated thiol reduction and changes in glutathione redox state .

What analytical techniques can distinguish between different subunit functions within the NAD(P)H-quinone oxidoreductase complex?

Distinguishing between the functions of different subunits within the NAD(P)H-quinone oxidoreductase complex requires sophisticated analytical approaches:

  • Immunological techniques:

    • Development of subunit-specific antibodies (e.g., anti-NdhB antibodies)

    • Western blot analysis to quantify individual subunit expression

    • Immunoprecipitation to isolate specific subunits with their interaction partners

  • Proteomic approaches:

    • Mass spectrometry-based identification of subunit-specific post-translational modifications

    • Cross-linking studies to map subunit interaction interfaces

    • Hydrogen-deuterium exchange mass spectrometry to assess conformational dynamics

  • Structural biology methods:

    • X-ray crystallography or cryo-electron microscopy of intact complexes

    • NMR studies of individual subunits to determine structure and dynamics

    • Computational modeling to predict subunit interactions and functional roles

  • Functional complementation strategies:

    • Expression of individual subunits in heterologous systems

    • Reconstitution experiments with purified subunits

    • Heterodimer approaches with tagged wild-type and mutant subunits

  • Enzyme kinetics with subunit-specific substrates:

    • Analysis of electron transfer rates with various electron acceptors

    • Determination of substrate specificity profiles for different subunits

    • Inhibitor studies targeting specific subunits

These techniques have demonstrated that some subunits operate independently with certain substrates while showing cooperative behavior with others. For example, heterodimer studies revealed that NAD(P)H-quinone oxidoreductase subunits function independently with two-electron acceptors but dependently with four-electron acceptors, providing important insights into the functional organization of this complex enzyme system .

What preparation protocols yield highest purity recombinant NAD(P)H-quinone oxidoreductase for structural studies?

To obtain high-purity recombinant NAD(P)H-quinone oxidoreductase suitable for structural biology applications, researchers should implement the following optimized protocol:

  • Expression optimization:

    • E. coli BL21(DE3) or Rosetta strains for efficient expression

    • Induction at OD600 = 0.6-0.8 with 0.2-0.5 mM IPTG

    • Lower temperature expression (16-18°C) overnight to enhance proper folding

    • Addition of 0.2% glucose to suppress basal expression before induction

  • Multi-step purification strategy:

    • Initial metal affinity chromatography using His-tagged constructs

    • Ion exchange chromatography to remove charged contaminants

    • Size exclusion chromatography as a final polishing step

    • Implementation of stringent quality control at each purification stage

  • Buffer optimization:

    • Tris/PBS-based buffer systems at pH 8.0

    • Addition of 6% trehalose as a stabilizing agent

    • Glycerol (5-50%) to prevent aggregation and maintain activity

    • Reducing agents (DTT or β-mercaptoethanol) to maintain thiol groups

  • Quality assessment criteria:

    • 95% purity as determined by SDS-PAGE

    • Monodispersity verified by dynamic light scattering

    • Thermal stability assessment using differential scanning fluorimetry

    • Activity verification through enzyme kinetics with standard substrates

This comprehensive approach ensures the production of homogeneous protein preparations suitable for crystallization trials, cryo-electron microscopy, or other structural biology techniques requiring highly purified samples.

How can researchers optimize assay conditions for measuring NAD(P)H-quinone oxidoreductase activity in different plant species?

Optimizing assay conditions for NAD(P)H-quinone oxidoreductase across different plant species requires careful consideration of several parameters:

  • Sample preparation considerations:

    • For chloroplast isolation, adapt buffer components based on plant species (e.g., higher BSA concentrations for recalcitrant species)

    • Perform all isolation steps at 4°C in darkness to prevent photooxidation

    • Use Percoll gradient centrifugation to obtain intact chloroplasts

    • Standardize chlorophyll content (10-20 μg chlorophyll per assay)

  • Buffer system optimization:

    • Test pH range (7.0-8.5) to determine species-specific optima

    • Adjust ionic strength based on stability considerations

    • Include appropriate osmolytes (0.33 M sorbitol) to maintain chloroplast integrity

    • Evaluate the need for specific ions (Mg2+, K+) for maximal activity

  • Substrate considerations:

    • Compare NADPH versus NADH as electron donors

    • Test various electron acceptors (natural quinones versus artificial acceptors)

    • Establish concentration ranges that provide linear reaction rates

    • Consider species-specific substrate preferences

  • Detection method selection:

    • Spectrophotometric monitoring of NAD(P)H oxidation at 340 nm

    • Fluorescence-based detection of NAD(P)H (excitation 340 nm, emission 460 nm)

    • Polarographic measurement of oxygen consumption/production

    • Species-specific considerations for background interference

  • Data analysis and normalization:

    • Express activity relative to chlorophyll content or protein amount

    • Apply appropriate kinetic models (Michaelis-Menten, cooperativity models)

    • Use multiple technical and biological replicates

    • Include appropriate controls for non-enzymatic reaction rates

These optimized protocols enable reliable comparison of NAD(P)H-quinone oxidoreductase activities across different plant species, accounting for species-specific differences in enzyme properties and assay interference factors.

What are the best approaches for investigating protein-protein interactions involving NAD(P)H-quinone oxidoreductase in chloroplast membranes?

Investigating protein-protein interactions involving NAD(P)H-quinone oxidoreductase in chloroplast membranes requires specialized techniques to overcome challenges associated with membrane proteins:

  • In vivo interaction studies:

    • Split-fluorescent protein complementation assays

    • Förster resonance energy transfer (FRET) with fluorescently-tagged proteins

    • Bimolecular fluorescence complementation (BiFC) in chloroplasts

    • In vivo cross-linking followed by co-immunoprecipitation

  • Membrane protein solubilization strategies:

    • Detergent screening to identify optimal solubilization conditions

    • Nanodisc reconstitution to maintain native-like membrane environment

    • Styrene maleic acid lipid particles (SMALPs) for detergent-free extraction

    • Careful optimization of lipid:protein ratios to maintain functional interactions

  • Affinity-based methods:

    • Pull-down assays using tagged NAD(P)H-quinone oxidoreductase subunits

    • Co-immunoprecipitation with subunit-specific antibodies

    • Tandem affinity purification to reduce non-specific interactions

    • Chemical cross-linking coupled with mass spectrometry (XL-MS)

  • Advanced biophysical techniques:

    • Surface plasmon resonance to measure binding kinetics

    • Isothermal titration calorimetry for thermodynamic parameters

    • Analytical ultracentrifugation to assess complex formation

    • Native mass spectrometry for intact complex analysis

  • Functional validation approaches:

    • Activity assays in reconstituted systems with defined components

    • Mutational analysis of predicted interaction interfaces

    • Competition assays with synthetic peptides mimicking interaction domains

    • Correlation of binding with functional parameters

These methodologies have been successfully applied to identify interactions between NAD(P)H-quinone oxidoreductase and other components of the photosynthetic electron transport chain, revealing how these interactions contribute to the regulation of electron flow in response to changing environmental conditions.

How can researchers address solubility issues when expressing recombinant NAD(P)H-quinone oxidoreductase subunits?

Solubility challenges are common when expressing membrane-associated proteins like NAD(P)H-quinone oxidoreductase subunits. To overcome these issues, researchers can implement the following strategies:

  • Expression system modifications:

    • Lower induction temperature (16-18°C) to slow protein synthesis and improve folding

    • Reduced IPTG concentration (0.1-0.2 mM) to decrease expression rate

    • Co-expression with molecular chaperones (GroEL/GroES, DnaK/DnaJ)

    • Use of specialized E. coli strains designed for membrane protein expression

  • Fusion tag approaches:

    • N-terminal solubility enhancers (MBP, SUMO, TrxA, GST)

    • Optimization of linker sequences between fusion partner and target protein

    • Inclusion of cleavage sites for tag removal after solubilization

    • Dual tagging strategies for enhanced solubility and purification

  • Buffer optimization:

    • Inclusion of mild detergents (0.1% Triton X-100, n-dodecyl-β-D-maltoside)

    • Addition of osmolytes (trehalose, sucrose, glycerol) to stabilize native structure

    • Screening of different pH conditions and salt concentrations

    • Incorporation of specific lipids to mimic native membrane environment

  • Refolding strategies for inclusion bodies:

    • Solubilization in chaotropic agents (8M urea or 6M guanidine hydrochloride)

    • Stepwise dialysis to gradually remove denaturants

    • Pulse refolding with rapid dilution methods

    • Refolding in the presence of artificial chaperones or lipid vesicles

  • Construct design considerations:

    • Bioinformatic analysis to identify and remove aggregation-prone regions

    • Expression of functional domains rather than full-length proteins

    • Codon optimization for improved translation efficiency

    • Site-directed mutagenesis of problematic residues without affecting function

Implementation of these strategies has successfully addressed solubility challenges in the expression of various NAD(P)H-quinone oxidoreductase subunits, enabling subsequent structural and functional studies of these important photosynthetic proteins.

What are the most effective methods for determining subunit stoichiometry in NAD(P)H-quinone oxidoreductase complexes?

Determining the precise subunit stoichiometry in NAD(P)H-quinone oxidoreductase complexes requires multiple complementary approaches to ensure accuracy and reliability:

  • Quantitative mass spectrometry approaches:

    • Absolute quantification (AQUA) using isotope-labeled peptide standards

    • Label-free quantification based on peptide intensity

    • Selected reaction monitoring (SRM) for targeted quantification

    • Data-independent acquisition (DIA) for comprehensive subunit analysis

  • Biophysical characterization methods:

    • Analytical ultracentrifugation to determine molecular weight and composition

    • Size exclusion chromatography coupled with multi-angle light scattering (SEC-MALS)

    • Native mass spectrometry to measure intact complex masses

    • Isothermal titration calorimetry to assess binding stoichiometry

  • Structural biology techniques:

    • X-ray crystallography to visualize subunit arrangement in crystal structures

    • Cryo-electron microscopy for direct observation of complex architecture

    • Small-angle X-ray scattering (SAXS) for solution-state structure determination

    • Negative stain electron microscopy for initial assessment of complex composition

  • Genetic and biochemical validation:

    • Co-expression of subunits with different tags for differential detection

    • Quantitative Western blotting with subunit-specific antibodies

    • Stepwise reconstitution experiments with purified components

    • Cross-linking coupled with mass spectrometry to map subunit interfaces

These complementary approaches provide robust determination of subunit stoichiometry in NAD(P)H-quinone oxidoreductase complexes, which is essential for understanding the functional organization and electron transfer mechanisms in these important photosynthetic enzyme systems.

What emerging technologies show promise for studying NAD(P)H-quinone oxidoreductase function in vivo?

Several cutting-edge technologies are revolutionizing our ability to study NAD(P)H-quinone oxidoreductase function in living systems:

  • Advanced imaging techniques:

    • Super-resolution microscopy (PALM, STORM, STED) for nanoscale visualization

    • Fluorescence lifetime imaging microscopy (FLIM) to measure redox states in vivo

    • Label-free imaging methods such as transient absorption microscopy

    • Correlative light and electron microscopy for structural-functional correlation

  • Genetically encoded biosensors:

    • NADPH-specific fluorescent reporters to track metabolic state in real-time

    • Redox-sensitive fluorescent proteins to monitor electron transfer events

    • FRET-based sensors for detecting protein-protein interactions in chloroplasts

    • Optogenetic tools for light-controlled manipulation of enzyme activity

  • Single-molecule techniques:

    • Single-molecule FRET to measure conformational dynamics

    • Optical tweezers combined with fluorescence for force-activity relationships

    • Single-molecule localization microscopy to track enzyme distribution

    • Patch-clamp techniques adapted for chloroplast membranes

  • CRISPR-based technologies:

    • Base editing for precise modification of specific amino acid residues

    • Prime editing for targeted introduction of specific mutations

    • CRISPR interference/activation for reversible regulation of gene expression

    • CRISPR-based imaging to visualize genomic loci encoding NAD(P)H-quinone oxidoreductase

  • Systems biology approaches:

    • Multi-omics integration (transcriptomics, proteomics, metabolomics)

    • Flux analysis using stable isotope labeling

    • Mathematical modeling of electron transport networks

    • Synthetic biology redesign of photosynthetic electron transport

These emerging technologies provide unprecedented opportunities to study NAD(P)H-quinone oxidoreductase function in its native context, offering insights into how this enzyme complex contributes to photosynthetic efficiency and plant adaptation to changing environmental conditions.

How might computational modeling advance our understanding of NAD(P)H-quinone oxidoreductase catalytic mechanisms?

Computational modeling approaches offer powerful tools for elucidating the complex catalytic mechanisms of NAD(P)H-quinone oxidoreductase at atomic and electronic levels:

  • Quantum mechanical/molecular mechanical (QM/MM) simulations:

    • Hybrid methods to model electron transfer reactions

    • Calculation of activation barriers for catalytic steps

    • Elucidation of proton-coupled electron transfer mechanisms

    • Investigation of substrate binding orientations and transition states

  • Molecular dynamics simulations:

    • Atomistic simulations to reveal protein dynamics and conformational changes

    • Enhanced sampling techniques to capture rare catalytic events

    • Coarse-grained models for long-timescale processes

    • Membrane protein simulations incorporating lipid interactions

  • Machine learning approaches:

    • Neural networks for predicting protein-substrate interactions

    • Classification algorithms to identify catalytically important residues

    • Deep learning models for enzyme engineering and optimization

    • Integration of experimental data with computational predictions

  • Systems-level modeling:

    • Kinetic models of electron transport chains

    • Thermodynamic analysis of energy conversion efficiency

    • Metabolic control analysis to identify rate-limiting steps

    • Multi-scale models linking molecular events to physiological responses

  • Structural bioinformatics:

    • Homology modeling for predicting structures of uncharacterized subunits

    • Evolutionary analysis to identify conserved catalytic motifs

    • Virtual screening for potential inhibitors or activity modulators

    • Protein-protein docking to predict subunit interfaces and assembly mechanisms

These computational approaches enable researchers to generate detailed mechanistic hypotheses about NAD(P)H-quinone oxidoreductase function that can be tested experimentally, accelerating our understanding of this complex enzyme system and potentially informing strategies for enhancing photosynthetic efficiency in crop plants.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.