Recombinant Olimarabidopsis pumila NAD (P)H-quinone oxidoreductase subunit 4L, chloroplastic

What is Olimarabidopsis pumila NAD(P)H-quinone oxidoreductase subunit 4L, chloroplastic?

Olimarabidopsis pumila NAD(P)H-quinone oxidoreductase subunit 4L (ndhE) is a chloroplastic protein that functions as part of the NAD(P)H dehydrogenase complex in the electron transport chain. This protein is encoded by the ndhE gene and serves as a component of NADH-plastoquinone oxidoreductase in chloroplasts. The full-length protein consists of 101 amino acids with the sequence: MILEHVLVLSAYLFLIGLYGLIMSRNMVRALMCLELILNAVNMNFVTFSDFFDNSQLKGDIFCIFVIAIAAAEAAIGLAIVSSIYRNRKSTRINQSTLLNK . The protein has a UniProt ID of A4QJY4 and is classified as part of the oxidoreductase family that catalyzes electron transfer reactions in photosynthetic organisms .

How does the NAD(P)H-quinone oxidoreductase function in plant chloroplasts?

NAD(P)H-quinone oxidoreductases in plant chloroplasts function primarily in cyclic electron transport around photosystem I, which is crucial for balancing the ATP/NADPH ratio required for carbon fixation. These enzymes catalyze the transfer of electrons from NAD(P)H to quinones in a two-electron reduction process, which helps prevent the formation of reactive semiquinone intermediates that could generate harmful reactive oxygen species . The catalytic mechanism involves a tightly bound FAD cofactor that is reduced by NAD(P)H in the first stage of a substituted enzyme (ping-pong) mechanism . Unlike many other dehydrogenases, NAD(P)H-quinone oxidoreductases work with similar efficiency using either NADH or NADPH as electron donors, providing metabolic flexibility to plant cells under varying conditions .

What is the evolutionary significance of ndhE in photosynthetic organisms?

The ndhE gene encoding NAD(P)H-quinone oxidoreductase subunit 4L is highly conserved across photosynthetic organisms, demonstrating its evolutionary importance. In Olimarabidopsis pumila (also known as Dwarf rocket or Arabidopsis griffithiana), this protein shares significant sequence homology with other Brassicaceae family members. The conservation of this subunit across diverse plant species suggests its fundamental role in photosynthetic efficiency, particularly under stress conditions. Comparative genomic analyses reveal that the ndh gene complex, including ndhE, has been maintained throughout the evolution of land plants, despite the high energy cost of producing and maintaining these protein complexes, underscoring their physiological significance for plant adaptation and survival.

What expression systems are optimal for producing recombinant Olimarabidopsis pumila NAD(P)H-quinone oxidoreductase subunit 4L?

For laboratory-scale production, E. coli expression systems have proven effective for expressing recombinant Olimarabidopsis pumila NAD(P)H-quinone oxidoreductase subunit 4L with N-terminal His-tags . When using E. coli, optimizing codon usage for bacterial expression is essential, as plant chloroplastic proteins often contain codons rarely used in E. coli. For larger-scale or more complex studies, Chinese Hamster Ovary (CHO) suspension cell lines could be considered, as they have demonstrated success with similar oxidoreductase proteins .

The expression methodology typically involves:

• Gene synthesis or PCR amplification of the ndhE coding sequence

• Cloning into an appropriate vector with an N-terminal His-tag

• Transformation into E. coli BL21(DE3) or similar expression strains

• Induction with IPTG at optimal concentration (typically 0.1-1.0 mM)

• Growth at reduced temperature (16-20°C) to enhance proper folding

• Cell lysis and protein purification via nickel affinity chromatography

What purification strategies yield the highest purity and activity for recombinant NAD(P)H-quinone oxidoreductase?

A multi-step purification approach is recommended to achieve >90% purity while maintaining enzymatic activity . The typical purification workflow includes:

• Initial Capture: Immobilized metal affinity chromatography (IMAC) using Ni-NTA resin for His-tagged proteins

• Intermediate Purification: Ion exchange chromatography (typically anion exchange at pH 8.0)

• Polishing Step: Size exclusion chromatography to remove aggregates and ensure homogeneity

Throughout purification, maintaining a reducing environment with 1-5 mM DTT or β-mercaptoethanol is critical to prevent oxidation of cysteine residues. Buffer optimization is essential, with Tris-based buffers (pH 7.5-8.0) containing 50% glycerol showing good results for stability . For long-term storage, aliquoting the purified protein and storing at -20°C or -80°C is recommended to prevent repeated freeze-thaw cycles, which can compromise protein activity .

What analytical methods are most effective for verifying the structural integrity of purified recombinant NAD(P)H-quinone oxidoreductase?

Multiple complementary techniques should be employed to comprehensively analyze the structural integrity of purified recombinant NAD(P)H-quinone oxidoreductase:

When analyzing NAD(P)H-quinone oxidoreductases, special attention should be paid to FAD cofactor binding, which can be assessed through spectrophotometric analysis at 450 nm. The presence of the bound FAD is essential for enzymatic activity and indicates proper protein folding. Additionally, native PAGE can be used to assess the formation of functional dimers, as active oxidoreductases typically function as homodimers with active sites formed from residues of both polypeptide chains .

How can the enzymatic activity of recombinant Olimarabidopsis pumila NAD(P)H-quinone oxidoreductase be accurately measured?

Enzymatic activity can be assessed using several complementary approaches:

• Spectrophotometric Assays:

  • NAD(P)H oxidation can be monitored by decreasing absorbance at 340 nm

  • Quinone reduction can be followed by changes in absorbance at specific wavelengths depending on the quinone substrate

  • Typical reaction mixture contains:

    • 50 mM Tris-HCl (pH 7.5)

    • 0.1-0.5 mM NAD(P)H

    • 0.01-0.1 mM quinone substrate (e.g., menadione, benzoquinone)

    • 0.1-1 μg purified enzyme

• Oxygen Consumption Assays:

  • Clark-type electrode measurements to monitor oxygen consumption during the enzymatic reaction

  • Useful for determining if the enzyme can use molecular oxygen as an electron acceptor

• Coupled Enzyme Assays:

  • Linking NAD(P)H oxidation to reduction of a reporter dye (e.g., MTT, DCPIP)

  • Provides higher sensitivity and is less prone to interference

Specific activity is typically expressed as μmol substrate converted per minute per mg protein under standard conditions (pH 7.5, 25°C). Kinetic parameters (Km, Vmax) should be determined for both NAD(P)H and various quinone substrates to characterize substrate specificity.

What is the role of NAD(P)H-quinone oxidoreductase in plant stress responses?

NAD(P)H-quinone oxidoreductases play crucial roles in plant stress responses through several mechanisms:

• Oxidative Stress Protection:

  • Two-electron reduction of quinones prevents formation of semiquinone radicals

  • Reduces oxidative damage by decreasing reactive oxygen species (ROS) production

  • Helps maintain cellular redox homeostasis under stress conditions

• Energy Balance Regulation:

  • Contributes to cyclic electron flow around photosystem I

  • Helps maintain optimal ATP/NADPH ratio during stress-induced metabolic changes

  • Particularly important under high light, drought, and temperature stress

• Xenobiotic Detoxification:

  • Reduces quinone-containing environmental toxins

  • Contributes to plant resistance against certain herbicides and pollutants

Research has shown that plants with altered expression of NAD(P)H-quinone oxidoreductases exhibit differential responses to environmental stresses, with knockdown mutants typically showing increased sensitivity to oxidative stress inducers. Functional analysis of Olimarabidopsis pumila NAD(P)H-quinone oxidoreductase might reveal species-specific adaptations related to its native habitat conditions.

How does the chloroplastic localization affect the function of NAD(P)H-quinone oxidoreductase?

The chloroplastic localization of NAD(P)H-quinone oxidoreductase subunit 4L is integral to its physiological function. As part of the chloroplast electron transport chain, this localization:

• Positions the enzyme for optimal interaction with photosynthetic components:

  • Direct access to NAD(P)H generated by photosystem I

  • Proximity to plastoquinone pools in thylakoid membranes

  • Integration into supercomplexes with other photosynthetic proteins

• Enables rapid response to redox changes during photosynthesis:

  • Helps balance electron flow during fluctuating light conditions

  • Contributes to photoprotection mechanisms

• Facilitates specific membrane association:

  • The hydrophobic regions of the protein (evident in the amino acid sequence MILEHVLVLSAYLFLIGLYGLIMSRNMVRALMCLELILNAVNMNFVTFSDFFDNSQLKGDIFCIFVIAIAAAEAAIGLAIVSSIYRNRKSTRINQSTLLNK) suggest membrane association

  • Proper orientation within thylakoid membranes is essential for electron transfer

Experimental approaches to study this include subcellular fractionation, fluorescence microscopy with GFP-fusion proteins, and import assays with isolated chloroplasts to confirm targeting and processing of the transit peptide.

How does Olimarabidopsis pumila NAD(P)H-quinone oxidoreductase subunit 4L compare to homologous proteins from other species?

Comparative analysis reveals both conserved and divergent features between Olimarabidopsis pumila NAD(P)H-quinone oxidoreductase subunit 4L and its homologs in other plant species:

The highest conservation is observed in the functional domains involved in electron transport and quinone binding, while greater variation exists in regions involved in membrane association and assembly with other subunits. These differences may reflect adaptations to specific environmental conditions or metabolic requirements of different plant species.

What structural features of NAD(P)H-quinone oxidoreductase contribute to its catalytic mechanism?

Key structural features contributing to the catalytic mechanism include:

• FAD Binding Domain:

  • Tightly binds the FAD cofactor which serves as an electron acceptor from NAD(P)H

  • Contains a conserved Rossmann fold typical of nucleotide-binding proteins

• NAD(P)H Binding Pocket:

  • Accommodates both NADH and NADPH with similar affinity

  • Contains positively charged residues that interact with the phosphate groups

• Quinone Binding Site:

  • Hydrophobic pocket that positions quinone substrates for efficient electron transfer

  • Contains residues that stabilize charge development during reduction

• Transmembrane Domains:

  • The amino acid sequence MILEHVLVLSAYLFLIGLYGLIMSRNMVRALMCLELILNAVNMNFVTFSDFFDNSQLKGDIFCIFVIAIAAAEAAIGLAIVSSIYRNRKSTRINQSTLLNK contains hydrophobic regions that facilitate membrane association

  • Proper orientation in the membrane is critical for interaction with membrane-bound quinones

• Dimerization Interface:

  • Residues involved in forming the functional homodimer

  • Creates the complete active sites at the interface between monomers

The catalytic mechanism follows a ping-pong bi-bi kinetic pattern where NAD(P)H reduces the FAD cofactor, followed by release of NAD(P)+ before quinone binding and subsequent reduction .

How does the interaction between NAD(P)H-quinone oxidoreductase and other chloroplastic proteins contribute to photosynthetic efficiency?

NAD(P)H-quinone oxidoreductase functions as part of a larger network of chloroplastic proteins that collectively optimize photosynthetic efficiency:

• Integration with Photosystem I (PSI):

  • Facilitates cyclic electron flow around PSI

  • Helps balance the ATP/NADPH ratio according to metabolic demands

  • Forms transient supercomplexes with PSI under specific conditions

• Interaction with Plastoquinone Pool:

  • Reduces oxidized plastoquinone to plastoquinol

  • Contributes to maintaining the redox state of the plastoquinone pool

  • Influences electron transfer rates between photosystems

• Coordination with Ferredoxin and Ferredoxin-NADP+ Reductase:

  • Alternative electron flow pathways that respond to varying light conditions

  • Regulatory crosstalk through shared substrates and products

• Association with Thylakoid Membrane Complexes:

  • Co-localization with other membrane proteins for efficient electron transfer

  • Participation in dynamic reorganization of thylakoid membranes during state transitions

These interactions can be studied using techniques such as blue-native PAGE, co-immunoprecipitation, and proximity labeling approaches followed by mass spectrometry to identify interacting partners.

What are the optimal conditions for reconstituting lyophilized recombinant NAD(P)H-quinone oxidoreductase for experimental use?

Proper reconstitution of lyophilized recombinant NAD(P)H-quinone oxidoreductase is critical for maintaining protein activity. The recommended protocol is:

• Centrifuge the vial briefly before opening to bring contents to the bottom

• Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL

• Add glycerol to a final concentration of 5-50% (50% is typically recommended)

• Aliquot into small volumes to avoid repeated freeze-thaw cycles

• Store reconstituted protein at -20°C for long-term storage or at 4°C for up to one week

For optimal activity, reconstitution buffer should be Tris/PBS-based with pH 8.0 . If the protein shows reduced activity after reconstitution, adding a reducing agent (1-5 mM DTT or β-mercaptoethanol) and trace amounts of FAD (1-10 μM) may help restore activity by ensuring proper cofactor binding and preventing oxidation of critical cysteine residues.

How can recombinant NAD(P)H-quinone oxidoreductase be used in drug discovery and biotechnology applications?

Recombinant NAD(P)H-quinone oxidoreductase has several valuable applications in research:

• Drug Discovery:

  • Screening platform for identifying inhibitors or activators

  • Target for developing herbicides that specifically disrupt plant metabolism

  • Model for studying resistance mechanisms against quinone-based antimicrobials

• Biocatalysis Applications:

  • Selective reduction of quinones and other electron-deficient compounds

  • Production of chirally pure compounds through stereoselective reductions

  • Development of enzyme cascades for complex biotransformations

• Biosensor Development:

  • Detection of quinones and related compounds in environmental samples

  • Monitoring oxidative stress in biological systems

  • Electrochemical sensors based on immobilized enzymes

• Comparative Studies:

  • Investigation of evolutionary adaptations in redox metabolism

  • Structure-function relationships across different species

  • Understanding specialized metabolic pathways in various plant lineages

When utilizing recombinant NAD(P)H-quinone oxidoreductase in these applications, it's important to consider enzyme stability, substrate specificity, and optimal reaction conditions for the specific application context.

What analytical challenges must be overcome when studying the kinetics of NAD(P)H-quinone oxidoreductase reactions?

Several analytical challenges must be addressed when studying NAD(P)H-quinone oxidoreductase kinetics:

• Spectral Interference:

  • Overlapping absorption spectra of NAD(P)H, FAD, and quinone substrates

  • Solution: Use of specific wavelengths with minimal overlap or development of HPLC-based assays

• Oxygen Sensitivity:

  • Potential reoxidation of reduced products by molecular oxygen

  • Solution: Conduct reactions under anaerobic conditions or use oxygen scavenging systems

• Product Inhibition:

  • NAD(P)+ and reduced quinones may inhibit the enzyme

  • Solution: Continuous flow systems or coupled enzyme assays to remove products

• Stability of Substrates and Products:

  • Quinones and hydroquinones can undergo spontaneous redox reactions

  • Solution: Freshly prepare solutions and include appropriate stabilizers

• Membrane Association Effects:

  • Altered kinetics in membrane-associated versus soluble enzyme forms

  • Solution: Compare kinetics in various environments (detergent micelles, liposomes, nanodiscs)

A robust analytical approach combines multiple techniques, including stopped-flow spectrophotometry for rapid reactions, HPLC for product characterization, and oxygen consumption measurements to fully characterize the reaction mechanisms.

What gene editing approaches could be used to study the function of NAD(P)H-quinone oxidoreductase in planta?

Several gene editing strategies can be employed to investigate NAD(P)H-quinone oxidoreductase function in plants:

• CRISPR/Cas9-Mediated Knockout:

  • Complete gene disruption to analyze loss-of-function phenotypes

  • Targeting critical catalytic residues to create enzymatically inactive variants

  • Multiplex editing to simultaneously target multiple subunits of the complex

• Base Editing and Prime Editing:

  • Introduction of specific point mutations without double-strand breaks

  • Creating variant proteins with altered substrate specificity or regulation

  • Modifying regulatory regions to alter expression patterns

• Conditional Gene Silencing:

  • Inducible RNAi systems to control the timing of gene silencing

  • Tissue-specific promoters to study function in specific cell types

  • Temperature-sensitive silencing to study developmental effects

• Knock-In Strategies:

  • Tagging with fluorescent proteins for localization studies

  • Adding affinity tags for protein complex purification

  • Creating reporter gene fusions to monitor expression dynamics

These approaches should be coupled with comprehensive phenotypic analysis, including photosynthetic efficiency measurements, stress response characterization, and metabolite profiling to fully understand the physiological implications of manipulating NAD(P)H-quinone oxidoreductase function.

How might structural biology approaches advance our understanding of NAD(P)H-quinone oxidoreductase catalytic mechanisms?

Advanced structural biology methods could provide critical insights into NAD(P)H-quinone oxidoreductase mechanisms:

• Cryo-Electron Microscopy (Cryo-EM):

  • High-resolution structures of the complete enzyme complex

  • Visualization of dynamic conformational changes during catalysis

  • Structural analysis of membrane-embedded forms

• X-ray Crystallography:

  • Atomic-resolution structures of the enzyme with bound substrates/products

  • Analysis of specific binding sites and catalytic residues

  • Comparison of structures from different plant species

• Nuclear Magnetic Resonance (NMR) Spectroscopy:

  • Dynamic information about protein flexibility and domain movements

  • Direct observation of hydrogen bonding networks involved in catalysis

  • Analysis of protein-ligand interactions in solution

• Molecular Dynamics Simulations:

  • Modeling of transition states and reaction trajectories

  • Investigation of substrate access channels and product release

  • Prediction of effects of specific mutations on catalytic efficiency

• Time-Resolved Spectroscopy:

  • Capturing intermediate steps in the electron transfer process

  • Measuring the kinetics of conformational changes during catalysis

  • Correlating structural dynamics with catalytic events

These approaches would help resolve current questions about the precise electron transfer pathways, the basis for NAD(P)H dual specificity, and the structural adaptations that enable function within the thylakoid membrane environment.

What is the potential role of NAD(P)H-quinone oxidoreductase in enhancing crop resilience to environmental stress?

NAD(P)H-quinone oxidoreductase engineering holds promise for improving crop resilience:

• Drought Tolerance Enhancement:

  • Optimizing cyclic electron flow to maintain ATP production during water stress

  • Reducing photooxidative damage when CO2 fixation is limited by stomatal closure

  • Maintaining redox homeostasis under water deficit conditions

• Heat Stress Adaptation:

  • Protecting photosynthetic apparatus from heat-induced damage

  • Maintaining electron flow efficiency at elevated temperatures

  • Reducing reactive oxygen species production during heat stress

• Light Stress Management:

  • Enhancing excess energy dissipation under high light conditions

  • Improving recovery from photoinhibition

  • Balancing electron flow during fluctuating light conditions

• Combined Stress Resilience:

  • Developing variants with enhanced stability under multiple stressors

  • Fine-tuning activity levels for optimal performance in specific environments

  • Creating regulatory modifications for stress-responsive expression

Translational research could involve targeted overexpression, engineering enzymes with enhanced stability, or introducing variants from stress-adapted plant species into crops. Field trials would be essential to evaluate performance under realistic agricultural conditions and to assess any potential trade-offs between stress resilience and yield parameters.

What are the most promising research gaps to address regarding NAD(P)H-quinone oxidoreductase function in photosynthetic organisms?

Several high-priority research gaps remain to be addressed:

• Regulatory Mechanisms:

  • Post-translational modifications affecting enzyme activity

  • Transcriptional and translational control under different environmental conditions

  • Role of protein-protein interactions in regulating enzyme function

• Structural Dynamics:

  • Conformational changes during the catalytic cycle

  • Membrane association dynamics and lipid interactions

  • Assembly process of the complete enzyme complex

• Species-Specific Adaptations:

  • Comparative analysis across diverse plant species

  • Correlation between enzyme properties and ecological niches

  • Evolutionary trajectories of functional specialization

• Integration with Metabolic Networks:

  • Cross-talk with other electron transport pathways

  • Influence on broader cellular metabolism beyond photosynthesis

  • Role in metabolic reprogramming during stress responses

Addressing these gaps will require interdisciplinary approaches combining molecular biology, biochemistry, structural biology, and systems biology to build a comprehensive understanding of NAD(P)H-quinone oxidoreductase function in the context of whole-plant physiology.

What standardized protocols should be developed to facilitate comparative studies of NAD(P)H-quinone oxidoreductases across species?

To enable meaningful comparative studies, the following standardized protocols should be developed:

• Enzyme Purification and Characterization:

  • Standardized expression systems and purification procedures

  • Unified assay conditions for activity measurements

  • Consistent methods for determining kinetic parameters

• Structural Analysis Pipelines:

  • Harmonized approaches for protein crystallization

  • Standardized data collection and processing for structural studies

  • Common frameworks for structural comparison and annotation

• Functional Genomics Workflows:

  • Consistent gene editing protocols across model species

  • Standardized phenotyping methodologies

  • Unified data collection for multi-omics studies

• Bioinformatic Analysis Frameworks:

  • Common pipelines for sequence and structural comparison

  • Standardized annotation of functional domains and critical residues

  • Integrated databases for cross-species comparison