Recombinant Olimarabidopsis pumila Photosystem II CP47 chlorophyll apoprotein (psbB)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Olimarabidopsis pumila Photosystem II CP47 Chlorophyll Apoprotein (psbB)

Recombinant Olimarabidopsis pumila Photosystem II CP47 chlorophyll apoprotein (psbB) is a bioengineered version of the native PSII core antenna protein. It is expressed in E. coli and purified for functional and structural studies. The protein is critical for light energy harvesting and stabilization of the Photosystem II (PSII) complex in oxygenic photosynthesis .

PropertyValue
Source OrganismOlimarabidopsis pumila (Dwarf rocket)
Gene NamepsbB
Protein LengthFull-length (1–508 amino acids)
TagN-terminal His tag
Purity>90% (SDS-PAGE verified)
Storage BufferTris/PBS-based buffer with 6% trehalose, pH 8.0
Storage Conditions-20°C/-80°C (avoid repeated freeze-thaw cycles)

Figure 1: Structural Features of Recombinant psbB
The protein contains six transmembrane domains (TMDs), with chlorophyll-binding sites critical for energy transfer. Recombinant psbB retains native-like secondary structure, enabling functional studies on PSII biogenesis and stress responses .

Functional Role in Photosystem II

The psbB protein (CP47) serves as a core antenna subunit in PSII, facilitating light absorption and energy transfer to the reaction center (RC). It binds 16 chlorophyll molecules and interacts with extrinsic proteins (e.g., PsbO, PsbP) to stabilize the oxygen-evolving complex (OEC) .

FunctionMechanism
Light HarvestingAbsorbs photons via chlorophyll and transfers energy to the PSII RC
Stability of PSII CoreMaintains structural integrity of the PSII dimer in thylakoid membranes
OEC CoordinationInteracts with PsbO, PsbP, and PsbQ to stabilize the Mn₄CaO₅ cluster

Key Structural Insights
Recombinant psbB studies reveal:

  • Chlorophyll Binding: Sites B1–B3 exhibit red-shifted excitation energies, critical for energy transfer .

  • Membrane Stability: The E-loop (extrinsic loop) between TMDs 5–6 interacts with luminal proteins to prevent photodamage .

Production and Purification

The recombinant psbB is produced via E. coli expression systems and purified using nickel affinity chromatography (His tag) .

StepDetails
Expression HostE. coli
InductionIPTG-induced expression at 37°C
PurificationNi-NTA resin chromatography
BufferTris/PBS with 6% trehalose (stabilizes protein during storage)

Challenges

  • Solubility: Requires careful handling to prevent aggregation.

  • Reconstitution: Recommended in deionized water with glycerol (5–50%) for long-term storage .

Comparative Analysis with Native psbB

FeatureRecombinant psbBNative psbB
Chlorophyll BindingPartially retainedFull native binding
Membrane IntegrationRequires in vitro reconstitutionNaturally embedded in thylakoids
StabilitySusceptible to denaturationStabilized by thylakoid environment

Note: Recombinant psbB may lack post-translational modifications (e.g., phosphorylation) present in native forms .

Future Directions

  • Biotechnology: Engineering psbB variants for improved photostability in biofuel crops.

  • Structural Biology: Solving high-resolution crystal structures to elucidate OEC coordination.

References provide production details; offer functional insights. Olimarabidopsis pumila’s stress tolerance contextualizes psbB’s relevance in extremophyte research.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
psbB; Photosystem II CP47 reaction center protein; PSII 47 kDa protein; Protein CP-47
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-508
Protein Length
full length protein
Species
Olimarabidopsis pumila (Dwarf rocket) (Arabidopsis griffithiana)
Target Names
psbB
Target Protein Sequence
MGLPWYRVHTVVLNDPGRLLSVHIMHTALVAGWAGSMALYELAVFDPSDPVLDPMWRQGM FVIPFMTRLGITNSWGGWNITGGTITNPGLWSYEGVAGAHIVFSGLCFLAAIWHWVYWDL EIFCDERTGKPSLDLPKIFGIHLFLSGVACFGFGAFHVTGLYGPGIWVSDPYGLTGKVQP VNPAWGVEGFDPFVPGGIASHHIAAGTLGILAGLFHLSVRPPQRLYKGLRMGNIETVLSS SIAAVFFAAFVVAGTMWYGSATTPIELFGPTRYQWDQGYFQQEIYRRVSAGLAENQSLSD AWSKIPEKLAFYDYIGNNPAKGGLFRAGSMDNGDGIAVGWLGHPVFRNKEGRELFVRRMP TFFETFPVVLVDGDGIVRADVPFRRAESKYSVEQVGVTVEFYGGELNGVSYSDPATVKKY ARRAQLGEIFELDRATLKSDGVFRSSPRGWFTFGHASFALLFFFGHIWHGARTLFRDVFA GIDPDLDAQVEFGAFQKLGDPTTKRQAV
Uniprot No.

Target Background

Function
CP47 (Photosystem II chlorophyll apoprotein) is a key component of the Photosystem II (PSII) core complex. It binds chlorophyll and plays a crucial role in catalyzing the primary light-induced photochemical reactions within PSII. PSII functions as a light-driven water:plastoquinone oxidoreductase, utilizing light energy to extract electrons from water, generating oxygen (O2) and a proton gradient that is subsequently used for ATP production.
Protein Families
PsbB/PsbC family, PsbB subfamily
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the structure and function of CP47 (psbB) in Photosystem II?

CP47 (PsbB) is a core antenna protein of Photosystem II with a molecular mass of approximately 47 kDa. Structurally, CP47 contains six transmembrane domains (TMDs) that anchor it within the thylakoid membrane. The protein binds approximately 16 chlorophyll a molecules and several β-carotene molecules, forming an internal antenna system that captures light energy and transfers it to the PSII reaction center .

Functionally, CP47 serves as a bridge between the external light-harvesting complexes and the PSII reaction center. It collects excitation energy from peripheral antenna complexes and channels this energy toward the PSII reaction center chlorophylls (P680), where charge separation occurs. Additionally, CP47 plays a crucial structural role in stabilizing the PSII core complex and participates in the coordination of water-splitting reactions at the oxygen-evolving complex .

How is CP47 integrated into the PSII assembly pathway?

The integration of CP47 into PSII follows a highly ordered assembly pathway:

  • Initial assembly begins with the formation of the D1-PsbI and D2-cytochrome b559 precomplexes

  • These precomplexes combine to form the minimal reaction center (RC)

  • CP47 is then incorporated to form the RC47a complex (lacking CP43)

  • Several low-molecular-mass (LMM) subunits including PsbH, PsbM, PsbT, and PsbR join to form RC47b

  • Subsequently, CP43 along with PsbK is incorporated to form the oxygen-evolving complex (OEC)-less PSII monomer

  • The OEC and additional LMM subunits attach to form the complete PSII core monomer

  • Finally, dimerization occurs to form the PSII-LHCII supercomplex

This sequential assembly pathway is conserved from cyanobacteria to higher plants, indicating the evolutionary importance of this process for photosynthetic function .

What factors influence CP47 synthesis and stability in chloroplasts?

Multiple factors influence CP47 synthesis and stability:

FactorRole in CP47 BiogenesisExperimental Evidence
FPB1Facilitates CP47 biogenesis50% reduction in CP47 synthesis in fpb1 mutants
PAM68Assists in CP47 assembly; may facilitate chlorophyll insertionReduced PSII assembly in mutants
PsbHRequired for CP47 synthesisCP47 synthesis blocked in PsbH-deficient Arabidopsis
Psb28Binds to C-terminus of CP47Assists CP47 integration into PSII RC
Translation machineryEnables co-translational insertionRibosome stalling observed during synthesis of last TMD

Pulse-labeling experiments in fpb1 mutants show that despite enhanced polysome association with psbB transcripts, CP47 synthesis is reduced to approximately 50% compared to wild-type plants. This suggests that the elongation or termination of translation, rather than initiation, is affected in these mutants .

How do auxiliary proteins cooperatively facilitate CP47 biogenesis?

The biogenesis of CP47 requires coordinated action of multiple auxiliary proteins that function in distinct but complementary roles:

FPB1 (Facilitator of PsbB biogenesis1) works synergistically with PAM68 (Photosynthesis Affected Mutant68) to assist CP47 biogenesis. Ribosome profiling reveals increased ribosome stalling when the last transmembrane domain segment of CP47 emerges from the ribosomal tunnel in fpb1 mutants, suggesting FPB1 plays a critical role in facilitating the translation of challenging CP47 segments .

In cyanobacteria, the PAM68 ortholog has been proposed to facilitate chlorophyll insertion into CP47, indicating this protein may function in cofactor attachment during CP47 assembly . The interplay between these factors creates a complex network of interactions that ensure proper CP47 folding, cofactor attachment, and membrane integration.

The temporal and spatial coordination of these auxiliary proteins remains an active area of research. Current evidence suggests a model wherein FPB1 and PAM68 work at different stages of CP47 biogenesis - FPB1 primarily during translation and initial membrane insertion, while PAM68 may function more in cofactor attachment and early assembly steps .

What are the mechanisms of co-translational insertion of CP47 into thylakoid membranes?

CP47, like many thylakoid proteins with multiple transmembrane domains, undergoes co-translational insertion into thylakoid membranes. This process involves several coordinated steps:

  • Ribosomes translate the psbB mRNA while associated with the thylakoid membrane

  • As transmembrane segments emerge from the ribosomal exit tunnel, they are recognized by membrane insertion machinery

  • Each transmembrane segment is sequentially inserted into the lipid bilayer

  • Ribosome stalling may occur at specific points, particularly when the last TMD segment emerges from the ribosomal tunnel

This co-translational insertion mechanism ensures proper folding and prevents aggregation of hydrophobic transmembrane domains in the aqueous stroma. Analysis of fpb1 mutants reveals that without proper facilitation, ribosome stalling increases during CP47 synthesis, particularly at challenging translation points such as the final TMD .

The co-translational insertion of CP47 likely requires coordination with chlorophyll synthesis and attachment pathways, as the protein must incorporate multiple chlorophyll molecules during its biogenesis. This coordination between protein synthesis, membrane insertion, and cofactor attachment represents a remarkable example of cellular orchestration in organellar biogenesis .

How does CP47 contribute to PSII repair mechanisms following photodamage?

PSII undergoes frequent photodamage, particularly to the D1 protein, necessitating an efficient repair cycle. CP47 plays several important roles in this repair process:

  • Upon high-light exposure, CP47 within the PSII-LHCII supercomplex becomes phosphorylated along with other core subunits

  • The damaged PSII complexes disassemble, and the PSII core monomer (containing CP47) migrates from grana stacks to stroma-exposed thylakoid membranes

  • The PSII core monomer undergoes partial disassembly, with CP47 remaining associated with the D2-side of the complex

  • After D1 degradation and replacement, CP43 is reincorporated to reform the PSII core

  • The repaired PSII core monomer migrates back to grana stacks for dimerization and supercomplex formation

What techniques are most effective for expressing and purifying recombinant CP47 protein?

Expressing and purifying functional recombinant CP47 presents significant challenges due to its multiple transmembrane domains and associated chlorophyll molecules. A methodological approach includes:

Expression Systems:

  • Bacterial systems (e.g., E. coli): Suitable for structural studies but lacks chlorophyll attachment

  • Algal/cyanobacterial systems: Provide native-like environment with chlorophyll synthesis machinery

  • Cell-free systems: Allow controlled incorporation of cofactors during translation

Purification Protocol:

  • Membrane solubilization using mild detergents (n-dodecyl β-D-maltoside or digitonin)

  • Affinity chromatography using engineered tags (His-tag, Strep-tag)

  • Size exclusion chromatography to separate CP47-containing complexes

  • Assessment of pigment content using absorption spectroscopy (chlorophyll a peaks at 436 and 663 nm)

For functional studies, co-expression with auxiliary factors such as PAM68 and FPB1 may improve proper folding and chlorophyll incorporation. Verification of proper folding can be assessed through circular dichroism spectroscopy and fluorescence measurements .

How can ribosome profiling be applied to study CP47 translation dynamics?

Ribosome profiling has emerged as a powerful technique to study the translation dynamics of chloroplast-encoded proteins like CP47. A comprehensive methodology includes:

  • Sample preparation:

    • Isolate intact chloroplasts from plant tissue

    • Treat with cycloheximide to freeze ribosomes during translation

    • Perform nuclease digestion to digest unprotected mRNA

  • Library preparation and sequencing:

    • Extract and purify ribosome-protected fragments (RPFs)

    • Prepare libraries for next-generation sequencing

    • Perform deep sequencing to obtain millions of reads

  • Data analysis:

    • Map reads to the chloroplast genome

    • Calculate ribosome occupancy along psbB mRNA

    • Identify ribosome pause sites, particularly at transmembrane domain junctions

  • Comparative analysis:

    • Compare wild-type to mutants lacking assembly factors (e.g., fpb1, pam68)

    • Quantify ribosome stalling indices at specific positions

    • Correlate stalling sites with protein structural features

This approach has revealed increased ribosome stalling when the last TMD segment of CP47 emerges from the ribosomal tunnel in fpb1 mutants, providing insight into the co-translational challenges during CP47 biogenesis .

What approaches can be used to study CP47-protein interactions during PSII assembly?

Several complementary approaches can be employed to investigate CP47 interactions during PSII assembly:

In vivo techniques:

  • Split-GFP complementation to visualize protein interactions in chloroplasts

  • Förster resonance energy transfer (FRET) to measure interaction distances

  • Bimolecular fluorescence complementation (BiFC) for interaction mapping

Biochemical approaches:

  • Co-immunoprecipitation with CP47-specific antibodies

  • Crosslinking mass spectrometry to capture transient interactions

  • Blue native gel electrophoresis followed by second-dimension SDS-PAGE

Advanced structural techniques:

  • Cryo-electron microscopy of assembly intermediates

  • Hydrogen-deuterium exchange mass spectrometry to map interaction surfaces

  • Single-particle analysis of assembly complexes

These approaches have revealed interactions between CP47 and assembly factors such as PAM68 and FPB1, as well as interactions with other PSII subunits during the stepwise assembly process .

How can researchers reconcile contradictory data between CP47 synthesis rates and polysome loading?

A common challenge in CP47 research involves contradictory data between polysome association and protein synthesis rates. In fpb1 mutants, enhanced polysome association with psbB transcripts was observed despite reduced CP47 synthesis (approximately 50% compared to wild-type) . This apparent contradiction can be analyzed through several approaches:

  • Translation elongation analysis:

    • Measure ribosome transit times using pulse-chase experiments

    • Analyze ribosome density at specific regions using ribosome profiling

    • Quantify translation completion rates versus initiation rates

  • Ribosome stalling quantification:

    • Calculate stalling indices at specific mRNA positions

    • Compare stalling patterns between wild-type and mutant plants

    • Correlate stalling with structural features of nascent CP47

  • Co-translational degradation assessment:

    • Perform pulse-chase experiments with proteasome inhibitors

    • Measure nascent chain stability during translation

    • Quantify abortive translation products

  • Integrated data interpretation framework:

ObservationPotential ExplanationValidation Approach
Increased polysome loadingEnhanced initiation or reduced elongationRibosome half-transit time measurements
Decreased CP47 synthesisElongation defects or co-translational degradationRibosome profiling plus proteomics
Ribosome stalling at TMD6Lack of proper membrane insertion machinerySite-specific crosslinking during translation

This integrated approach provides a framework for understanding the apparent contradiction and reveals that enhanced polysome association likely results from elongation defects rather than increased initiation, explaining the reduced synthesis despite increased ribosome loading .

What considerations are important when analyzing mutant phenotypes affecting CP47 biogenesis?

When analyzing mutants with defects in CP47 biogenesis (e.g., fpb1, pam68), several important considerations can help disentangle direct from indirect effects:

  • Primary versus secondary effects:

    • Evaluate the temporal sequence of molecular changes

    • Determine whether phenotypes appear before or after CP47 reduction

    • Use inducible systems to track the progression of defects

  • Specificity analysis:

    • Compare effects on CP47 versus other PSII subunits

    • Measure transcript and protein levels of multiple photosynthetic components

    • Perform rescue experiments with recombinant proteins

  • Functional redundancy assessment:

    • Identify potential compensatory mechanisms

    • Create and analyze double or triple mutants

    • Perform complementation tests with related proteins

  • Quantitative phenotyping framework:

Phenotypic LevelMeasurement ApproachesInterpretation Challenges
MolecularProtein/transcript quantification, pulse labelingDistinguishing cause from effect
BiochemicalComplex assembly analysis (BN-PAGE), electron transportIndirect consequences on other components
PhysiologicalPhotosynthetic parameters, growth analysisPleiotropic effects
DevelopmentalChloroplast ultrastructure, plant morphologyLong-term adaptations

By systematically analyzing phenotypes across these levels and comparing different mutant lines affecting CP47 biogenesis, researchers can build a comprehensive understanding of the specific roles of auxiliary factors like FPB1 and PAM68 in the CP47 assembly pathway .

What are the promising approaches for studying chlorophyll attachment to CP47 during its biogenesis?

Understanding chlorophyll attachment to CP47 during biogenesis remains challenging yet crucial for comprehending PSII assembly. Several promising research directions include:

  • Time-resolved spectroscopy:

    • Track chlorophyll incorporation using pulse-chase experiments with labeled precursors

    • Measure energy transfer efficiency during assembly using ultrafast spectroscopy

    • Monitor chlorophyll-protein interactions using site-specific labels

  • Structural biology approaches:

    • Utilize cryo-electron microscopy to capture assembly intermediates

    • Apply crosslinking mass spectrometry to identify chlorophyll-binding residues

    • Develop in vitro reconstitution systems with purified components

  • Genetic engineering strategies:

    • Create point mutations in chlorophyll-binding residues of CP47

    • Develop conditional mutants in chlorophyll synthesis and attachment pathways

    • Engineer synthetic assembly systems with controllable components

These approaches could reveal how auxiliary proteins like PAM68, which has been implicated in chlorophyll insertion in cyanobacteria, coordinate with chlorophyll synthesis pathways to ensure proper pigment attachment during CP47 biogenesis .

How might systems biology approaches advance our understanding of PSII assembly coordination?

Systems biology approaches offer powerful tools to understand the coordinated assembly of PSII components:

  • Multi-omics integration:

    • Combine transcriptomics, proteomics, and metabolomics data

    • Track changes across multiple timescales during assembly

    • Generate predictive models of assembly pathways

  • Network analysis:

    • Construct protein-protein interaction networks centered on CP47

    • Identify regulatory hubs controlling assembly processes

    • Map genetic interactions through systematic mutant analysis

  • Spatiotemporal modeling:

    • Develop computational models of assembly dynamics

    • Simulate the effects of perturbations on assembly efficiency

    • Predict rate-limiting steps in the assembly process

This systems-level understanding could reveal how the synthesis of CP47 is coordinated with the production of other PSII components and cofactors, ensuring the efficient assembly of functional photosynthetic complexes .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.