Recombinant Olimarabidopsis pumila Photosystem Q (B) protein

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Olimarabidopsis pumila Photosystem Q(B) Protein

The recombinant Olimarabidopsis pumila Photosystem Q(B) protein (UniProt ID: A4QJR4) is a bioengineered version of the Photosystem II (PSII) D1 protein, a core component critical for light-driven water oxidation in photosynthesis. Native to Olimarabidopsis pumila (a halophyte with enhanced photosynthetic efficiency), this protein is expressed in E. coli with an N-terminal His tag for purification . It spans 344 amino acids (1–344) and is commercially available as a lyophilized powder with >90% purity .

Amino Acid Sequence

The sequence begins with:
MTAILERRESESLWGRFCNWITSTENRLYIGWFGVLMIPTLLTATSVFIIAFIAAPPVDI...
(Full sequence available in )

Functional Relevance in Photosynthesis

This protein corresponds to the D1 subunit of PSII, a critical site for:

  • Light absorption and energy transfer: Integrates with chlorophyll and pheophytin to stabilize charge separation .

  • Water oxidation: Serves as a scaffold for the Mn₄CaO₅ cluster in the oxygen-evolving complex (OEC) .

  • Photoprotection and repair: Susceptible to oxidative damage under high light (photoinhibition), necessitating turnover .

Expression System

Produced in E. coli via recombinant DNA technology, leveraging bacterial expression for scalability. The His tag enables affinity chromatography purification .

Quality Control

  • Purity: >90% confirmed via SDS-PAGE .

  • Stability: Repeated freeze-thaw cycles are discouraged; store at -20°C/-80°C .

Comparative Insights with Native PSII Proteins

FeatureRecombinant D1 (A4QJR4)Native PSII D1
SourceE. coli (engineered) O. pumila thylakoids
TagN-terminal His Untagged (native)
StabilityRequires cold storage Membrane-bound (in vivo)
Use CaseBiochemical assays, structural studiesNative function in photosynthesis

Research Gaps and Future Directions

  1. Functional validation: Limited data on enzymatic activity (e.g., O₂ evolution rates) of the recombinant protein.

  2. Stress response studies: Potential to model O. pumila’s salt tolerance using this protein in heterologous systems.

  3. Oxidation dynamics: Trp oxidation sites (e.g., Trp-14, Trp-317) merit further study for photoprotection mechanisms .

Product Specs

Form
Lyophilized powder
Please note: We prioritize shipping the format currently in stock. However, if you have specific requirements for the format, kindly indicate them in your order. We will fulfill your request if possible.
Lead Time
Delivery times may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery estimates.
Note: All our proteins are shipped with standard blue ice packs by default. If dry ice shipment is required, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to collect the contents at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. For long-term storage, we suggest adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our standard final concentration of glycerol is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, storage temperature, and the protein's inherent stability.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during the production process. If you have a preferred tag type, please inform us, and we will prioritize development of the specified tag.
Synonyms
psbA; Photosystem II protein D1; PSII D1 protein; Photosystem II Q(B protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-344
Protein Length
full length protein
Species
Olimarabidopsis pumila (Dwarf rocket) (Arabidopsis griffithiana)
Target Names
psbA
Target Protein Sequence
MTAILERRESESLWGRFCNWITSTENRLYIGWFGVLMIPTLLTATSVFIIAFIAAPPVDI DGIREPVSGSLLYGNNIISGAIIPTSAAIGLHFYPIWEAASVDEWLYNGGPYELIVLHFL LGVACYMGREWELSFRLGMRPWIAVAYSAPVAAATAVFLIYPIGQGSFSDGMPLGISGTF NFMIVFQAEHNILMHPFHMLGVAGVFGGSLFSAMHGSLVTSSLIRETTENESANEGYRFG QEEETYNIVAAHGYFGRLIFQYASFNNSRSLHFFLAAWPVVGIWFTALGISTMAFNLNGF NFNQSVVDSQGRVINTWADIINRANLGMEVMHERNAHNFPLDLA
Uniprot No.

Target Background

Function
Photosystem II (PSII) is a light-driven water:plastoquinone oxidoreductase that utilizes light energy to extract electrons from H(2)O, producing O(2) and a proton gradient subsequently used for ATP formation. It comprises a core antenna complex that captures photons and an electron transfer chain that converts photonic excitation into a charge separation. The D1/D2 (PsbA/PsbA) reaction center heterodimer binds P680, the primary electron donor of PSII, as well as several subsequent electron acceptors.
Protein Families
Reaction center PufL/M/PsbA/D family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

Basic Research Questions

  • What is Olimarabidopsis pumila and why is it significant for photosynthesis research?

    Olimarabidopsis pumila (synonym: Arabidopsis pumila) is an ephemeral brassicaceous plant closely related to the model organism Arabidopsis thaliana, but possesses enhanced stress tolerance capabilities. It inhabits semi-arid regions of Xinjiang, China, where over 90 million hectares are exposed to saline conditions . O. pumila has evolved enhanced photosystem II activities under high light conditions and demonstrates superior salt tolerance compared to A. thaliana, making it an ideal organism for studying photosynthetic adaptations to extreme environmental conditions . The species has been reclassified from Arabidopsis based on molecular phylogenetic analyses and distinctive morphological features such as yellow flowers, auriculate cauline leaves, and specific trichome patterns .

  • How does the recombinant version of O. pumila Photosystem Q(B) protein differ from the native form?

    The recombinant version of O. pumila Photosystem Q(B) protein is typically produced in E. coli expression systems with an N-terminal His-tag fusion to facilitate purification . Unlike the native protein embedded in thylakoid membranes with associated cofactors and protein partners, the recombinant form lacks the native lipid environment and may not maintain all structural features found in vivo. The recombinant protein is typically supplied as a lyophilized powder with >90% purity as determined by SDS-PAGE and requires reconstitution in appropriate buffers, often with glycerol addition for stability . While the amino acid sequence remains identical to the native form, post-translational modifications present in the plant are absent in the E. coli-expressed protein, potentially affecting certain functional aspects, though the primary structure and many biochemical properties remain suitable for research applications.

Advanced Research Questions

  • What are the energetics of the QB binding site in Photosystem II and how do they relate to O. pumila's stress adaptation?

    The energetics of the QB binding site in Photosystem II involve complex redox relationships that are fundamental to photosynthetic electron transport. Based on EPR spectroscopy measurements in similar photosystems, the midpoint potentials for the two QB redox couples have been measured: E°(QB/QB- −) ≈ 90 mV and E°(QB- −/QBH2) ≈ 40 mV . These values indicate several important functional aspects:

    Redox CoupleMidpoint PotentialFunctional Significance
    QB/QB- −~90 mVThermodynamic stabilization of semiquinone
    QB- −/QBH2~40 mVDriving force for electron transfer from QA
    QB/QBH2 (average)~65 mVLower than pool potential (~117 mV)

    The difference between E°(QB/QBH2) and E°(PQ/PQH2) of approximately 50 meV represents the driving force for QBH2 release into the plastoquinone pool . In O. pumila, these energetics may be tuned to function optimally under stress conditions, particularly high light and salinity, where the protein demonstrates enhanced stability and efficiency compared to less stress-tolerant species . The higher stability of the semiquinone (QB- −) minimizes back-reactions and electron leakage to oxygen, contributing to the plant's enhanced photosynthetic performance under stress conditions .

  • How can researchers optimize reconstitution and storage conditions for recombinant O. pumila Photosystem Q(B) protein to maintain functionality?

    Optimal reconstitution and storage of recombinant O. pumila Photosystem Q(B) protein requires careful attention to several parameters:

    1. Initial reconstitution: The lyophilized protein should be briefly centrifuged prior to opening to bring contents to the bottom. Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL .

    2. Buffer and stabilizing agents: For long-term storage, add glycerol to a final concentration of 50%. The standard storage buffer contains Tris/PBS-based buffer with 6% trehalose at pH 8.0 .

    3. Storage temperature: Store at -20°C/-80°C for extended periods. Working aliquots can be maintained at 4°C for up to one week .

    4. Freeze-thaw management: Repeated freeze-thaw cycles significantly reduce protein activity. Prepare single-use aliquots during initial reconstitution to avoid multiple freeze-thaw cycles .

    5. Membrane protein considerations: As a membrane protein, functionality may be enhanced by reconstitution into liposomes or nanodiscs that mimic the native thylakoid membrane environment, particularly for functional assays.

    These conditions help maintain the structural integrity of the protein while preserving its ability to bind quinones and participate in electron transfer reactions in experimental settings.

  • What methodologies can be used to assess the functional integrity of recombinant O. pumila Photosystem Q(B) protein in experimental systems?

    Several methodologies can be employed to assess the functional integrity of recombinant O. pumila Photosystem Q(B) protein:

    1. Electron Paramagnetic Resonance (EPR) spectroscopy: Can measure the formation and stability of the QB- − semiquinone signal and the QA- −Fe2+QB- − biradical signal, providing information about electron transfer capabilities .

    2. Fluorescence spectroscopy: Changes in chlorophyll fluorescence when the protein is incorporated into membrane systems can indicate functional electron transfer from QA to QB. The ratio (FM−FS)/FM, where FM is the maximum fluorescence yield and FS is the steady-state fluorescence, can quantitatively assess electron transfer efficiency .

    3. Chronoamperometry: Can measure sustained electron transfer when the protein is incorporated into electrode systems, particularly useful for assessing modifications that may affect electron transfer pathways .

    4. Binding assays with radiolabeled or fluorescent quinone analogs: Can determine whether the QB binding pocket remains intact and functional in the recombinant protein.

    5. Thermoluminescence: The pH dependence of thermoluminescence associated with QB- − can provide a functional estimate of the energy gap between QA/QA- − and QB/QB- − redox couples .

    These methods provide complementary information about different aspects of protein function, from binding capabilities to electron transfer kinetics.

  • What are the differences between the D1 (Q(B)) and D2 proteins in O. pumila Photosystem II and their respective roles in photosynthetic electron transport?

    The D1 (Q(B)) and D2 proteins in O. pumila Photosystem II serve as the core reaction center proteins but have distinct structures and functions:

    FeatureD1 (Q(B)) ProteinD2 Protein
    GenepsbApsbD
    Length344 amino acids353 amino acids
    Primary functionBinds QB and facilitates electron transfer to plastoquinone poolBinds QA and participates in initial electron acceptance
    Turnover rateHigh (susceptible to photodamage)Lower (more stable)
    Binding pocketContains QB binding siteContains QA binding site
    Mutation sensitivityHighly sensitive to mutationsModerately sensitive to mutations

    The D1 protein (psbA gene product) provides the binding environment for QB, the mobile plastoquinone that accepts electrons and protons to become plastoquinol (QBH2) before diffusing into the membrane . The D2 protein (psbD gene product) hosts the QA binding site, where the permanently bound plastoquinone accepts electrons from pheophytin and transfers them to QB .

    D1 undergoes rapid turnover during photosynthesis due to photodamage, particularly under high light conditions, while D2 is relatively more stable. Both proteins coordinate cofactors essential for the water-splitting and electron transport functions of PSII, but D1 is more directly involved in the oxygen-evolving reactions and consequently experiences greater oxidative damage .

  • How do the redox properties of the QB site in O. pumila compare to those in other photosynthetic organisms, and what implications does this have for research?

    The redox properties of the QB site in O. pumila can be compared to those in other photosynthetic organisms to understand evolutionary adaptations:

    OrganismE°(QB/QB- −)E°(QB- −/QBH2)Adaptation Context
    O. pumila~90 mV (estimated)~40 mV (estimated)Arid, high-salt environments
    Thermosynechococcus elongatus90 mV40 mVThermophilic cyanobacterium
    Arabidopsis thalianaLower (estimated)Similar (estimated)Mesic environments
    Purple bacterial reaction centersComparableComparableAnoxygenic photosynthesis

    The similarities in QB energetics between O. pumila and thermophilic cyanobacteria may reflect convergent evolution for stress resistance. The redox properties in O. pumila likely contribute to its enhanced photosystem II activities under high light conditions .

    For researchers, these comparisons have several implications:

    1. O. pumila provides a valuable model for studying stress-adaptive modifications to photosynthetic electron transport.

    2. The similarity to bacterial reaction centers suggests fundamental conservation of quinone reduction mechanisms across diverse photosynthetic systems .

    3. Differences in redox properties correlate with habitat-specific adaptations, making O. pumila particularly valuable for studying salinity and drought adaptations in photosynthesis.

    4. The enhanced stability of the semiquinone state in O. pumila may contribute to reduced reactive oxygen species production under stress conditions, offering insights for engineering stress-tolerant crops .

Methodological Questions

  • What experimental approaches can be used to study the interaction between recombinant O. pumila Photosystem Q(B) protein and quinone molecules?

    Several experimental approaches can be employed to study interactions between recombinant O. pumila Photosystem Q(B) protein and quinone molecules:

    1. Site-directed mutagenesis: Modify specific amino acids in the QB binding pocket to assess their contribution to quinone binding and electron transfer. This approach has been successful in studies with other photosystems to identify residues critical for quinone interactions .

    2. Quinone competition assays: Using various quinone analogs such as 2,6-dimethyl-p-benzoquinone (DMBQ) to compete with native plastoquinone can reveal binding preferences and electron transfer capabilities .

    3. Fluorescence quenching studies: When incorporated into liposomes with chlorophyll, the efficiency of quinone reduction can be assessed by measuring chlorophyll fluorescence quenching, similar to the approach used in studies of Chlamydomonas reinhardtii .

    4. EPR spectroscopy: Detects formation of the semiquinone radical (QB- −) during electron transfer, providing information about the redox state and stability of bound quinones .

    5. Isothermal titration calorimetry (ITC): Measures binding thermodynamics between the protein and various quinones, revealing binding affinities and energetics.

    6. Electrochemical methods: Techniques such as cyclic voltammetry can measure electron transfer to and from quinones when the protein is immobilized on electrodes .

    These approaches provide complementary information about binding specificity, electron transfer kinetics, and structural requirements for quinone interactions.

  • How can researchers effectively compare photoinhibition and repair mechanisms in O. pumila with those in other plant species like Arabidopsis thaliana?

    Effective comparison of photoinhibition and repair mechanisms between O. pumila and other plant species requires multi-faceted approaches:

    1. Parallel stress treatments: Subject both species to identical high light, temperature, and salinity stresses under controlled conditions to ensure comparable results .

    2. Chlorophyll fluorescence parameters: Measure and compare key parameters including:

      • Maximum quantum efficiency of PSII (Fv/Fm)

      • Energy-dependent exciton quenching (qE)

      • Photoinhibitory quenching (qI)

      • Linear electron flow (LEF)

      • Relative Q(A) redox status (qL)

    3. D1 protein turnover assessment: Use protein synthesis inhibitors like lincomycin (3 mM) to block chloroplast translation, allowing measurement of D1 degradation rates without repair . Compare:

      • D1 degradation kinetics under high light (e.g., 1000 μmol photons m−2 s−1 red light)

      • Recovery kinetics following transfer to low light

      • D1 protein half-life under various stress conditions

    4. Proton motive force (pmf) measurements: Use spectroscopic techniques to compare the relationship between pmf, electron transport rate, and photoinhibition between species .

    5. Protein phosphorylation analysis: Compare PSII protein phosphorylation patterns, particularly D1/D2 phosphorylation levels and STN8 kinase abundance in response to high light .

    6. Thylakoid membrane composition: Analyze lipid-to-chlorophyll ratios and chlorophyll-to-carotenoid ratios, which may differ significantly between species (e.g., Ws-4 Arabidopsis displays 30% more thylakoid lipids per chlorophyll and 40% less chlorophyll per carotenoid than Col-0) .

    This multi-parameter approach allows researchers to pinpoint specific differences in photoinhibition sensitivity and repair efficiency between O. pumila and other species, potentially revealing adaptive mechanisms for enhanced stress tolerance.

  • What considerations are important when designing experiments using recombinant O. pumila Photosystem proteins for electron transfer studies?

    When designing experiments using recombinant O. pumila Photosystem proteins for electron transfer studies, researchers should consider several key factors:

    1. Protein environment: Native membrane proteins function within a lipid bilayer environment. Consider:

      • Reconstitution into liposomes or nanodiscs

      • Addition of specific lipids found in thylakoid membranes

      • Surface immobilization strategies that maintain protein orientation

    2. Redox partners and mediators: Select appropriate partners based on experimental goals:

      • Natural electron donors/acceptors (plastoquinone, cytochrome)

      • Artificial mediators (DMBQ can be used as an electron mediator to assess efficiency)

      • Consider redox potential matching between partners

    3. Detection systems:

      • Spectroscopic methods (absorption changes at specific wavelengths)

      • Fluorescence-based detection (chlorophyll fluorescence changes)

      • Electrochemical detection (chronoamperometry, cyclic voltammetry)

      • EPR for radical detection

    4. Experimental conditions:

      • pH optimization (typically pH 6.0-8.0)

      • Salt concentration effects on electron transfer

      • Temperature control (25°C standard, but comparison at elevated temperatures may reveal stress-adaptive properties)

      • Light sources (red actinic illumination prevents chloroplast movement artifacts)

    5. Control experiments:

      • Parallel experiments with well-characterized photosystems (e.g., from A. thaliana)

      • Inactive protein controls (heat-denatured or critical residue mutants)

      • Background electron transfer in the absence of proteins

    6. Quantification methods:

      • For PSII activity, the ratio (FM−FS)/FM provides quantitative assessment of electron transfer efficiency

      • First-order rate constants for electron transfer steps

      • Steady-state turnover numbers

    These considerations help ensure that experimental results accurately reflect the electron transfer properties of O. pumila Photosystem proteins and allow valid comparisons with other photosynthetic systems.

Research Applications Questions

  • How can genomic and transcriptomic data from O. pumila inform our understanding of the evolution of photosynthetic systems under stress conditions?

    Genomic and transcriptomic data from O. pumila provide valuable insights into photosynthetic system evolution under stress conditions:

    1. Comparative genomics: Analysis of the psbA and related genes in O. pumila relative to other Brassicaceae reveals selection pressures on photosynthetic machinery. The cDNA library construction from O. pumila has identified numerous transcripts related to photosynthesis and salt stress, indicating potential coordination between these processes .

    2. Transcriptional responses: Gene expression analysis of salt-stressed O. pumila shows that chloroplast (13.4%) and plastid (8.3%) genes are most enriched within the "cellular component" category, highlighting the central role of photosynthetic adaptations in stress response .

    3. Stress-specific adaptations: The transcriptome of O. pumila reveals:

      • Unique photosynthetic gene variants not found in less stress-tolerant relatives

      • Co-expression networks linking photosynthetic and stress-response genes

      • Adaptation signatures in genes encoding photosystem components

    4. Evolutionary rate analysis: Comparison of synonymous vs. non-synonymous substitution rates in photosynthetic genes across Brassicaceae species can reveal whether genes like psbA have undergone positive selection in the O. pumila lineage.

    5. Functional verification: Transgenic expression of O. pumila photosynthetic genes in model organisms can verify their contribution to stress tolerance, potentially providing "new gene targets for improving crop resistance to abiotic stress by the genetic engineering technology" .

    This integrative approach connects genomic insights with functional adaptations, revealing how selection under extreme conditions has shaped photosynthetic machinery and offering insights for crop improvement strategies.

  • What are the challenges and solutions for studying electron transfer kinetics in isolated recombinant Photosystem Q(B) protein compared to intact PSII complexes?

    Studying electron transfer kinetics in isolated recombinant Photosystem Q(B) protein presents several challenges compared to intact PSII complexes:

    ChallengeDescriptionSolution Approaches
    Lack of native cofactorsRecombinant proteins often lack properly assembled cofactors essential for electron transferReconstitution with purified cofactors; partial assembly with key components
    Absence of lipid environmentNative membrane context is missing, affecting protein conformationIncorporation into liposomes or nanodiscs mimicking thylakoid composition
    Incomplete electron transfer chainMissing donor/acceptor componentsUsing artificial electron donors/acceptors; constructing minimal functional units
    Protein stability issuesTendency to aggregate or denatureOptimized buffer conditions; fusion partners; specific detergents
    Orientation and organizationRandom orientation vs. organized arrays in thylakoidsSurface immobilization with controlled orientation; self-assembly systems
    Quantitative assessmentDifficult to compare rates with native systemsComparative rates with model substrates; focus on relative changes

    Researchers have addressed these challenges using several innovative approaches:

    1. Design of minimal functional units: Engineering truncated versions that retain QB binding and electron acceptance capabilities while being more stable than full complexes .

    2. Site-directed mutations: Modifying the QB binding environment to enhance interaction with exogenous quinones, as demonstrated in the Q(A) binding site of Chlamydomonas reinhardtii .

    3. Artificial mediator systems: Using mediators like 2,6-dimethyl-p-benzoquinone (DMBQ) that can effectively accept electrons and be measured through various techniques .

    4. Hybrid systems: Combining recombinant proteins with minimal thylakoid preparations to provide a more complete electron transfer environment.

    5. Advanced spectroscopic techniques: Employing fast time-resolved spectroscopy to detect even transient electron transfer events that might be missed in steady-state measurements.

    These approaches allow researchers to gain valuable insights into the fundamental properties of the QB site while acknowledging the limitations of working with isolated recombinant components.

  • How might findings from O. pumila Photosystem II research contribute to the development of artificial photosynthetic systems or bio-hybrid energy technologies?

    Research on O. pumila Photosystem II components offers several promising contributions to artificial photosynthetic systems and bio-hybrid energy technologies:

    1. Enhanced stress resilience: O. pumila has evolved enhanced PSII activities under high light conditions , providing templates for engineering robust artificial systems that can operate under variable environmental conditions.

    2. Optimized electron transfer: The redox properties of O. pumila's QB site may reveal design principles for efficient electron transfer chains in artificial systems. The estimated energy gap between QA/QA- − and QB/QB- − in photosystems (~234 meV) represents a significant driving force for electron transfer that could be mimicked in synthetic systems .

    3. Bio-hybrid electrode design: Research on rerouting photosynthetic electron flow without compromising phototropic properties provides insights for harvesting electrons from photosystems for electricity generation. Studies demonstrating that shortening the distance between QA and exogenous quinones increases electron transfer rates could inform the design of bio-hybrid interfaces.

    4. Improved protein stability: Understanding how O. pumila's photosynthetic proteins maintain function under stress could inform protein engineering approaches for enhanced stability in artificial systems. The relationship between protein phosphorylation, thylakoid membrane stacking, and PSII repair provides design principles for self-healing synthetic systems.

    5. Biomimetic catalysts: Detailed structural understanding of the QB binding pocket could inspire the development of synthetic catalysts that mimic its electron and proton-coupled reactions for energy conversion applications.

    6. Quinone binding optimization: Insights into the binding preferences and reduction mechanisms of plastoquinone at the QB site could inform the selection or design of electron mediators in bio-electrochemical systems.

    These contributions would address key challenges in artificial photosynthesis, including efficiency, stability, and scalability, potentially advancing sustainable energy technologies based on biological principles.

  • What approaches can researchers use to investigate the relationship between proton motive force and photoinhibition in O. pumila compared to less stress-tolerant species?

    Researchers can employ several sophisticated approaches to investigate the relationship between proton motive force (pmf) and photoinhibition in O. pumila compared to less stress-tolerant species:

    1. In vivo spectroscopic measurements: Following dark acclimation (10 min), measure maximal PSII quantum efficiency, linear electron flow (LEF), energy-dependent exciton quenching (qE), and photoinhibitory quenching (qI) using saturation pulse chlorophyll fluorescence techniques .

    2. Proton conductivity assessment: Determine the conductivity of ATP synthase to protons (gH+) and the relative extents of steady-state pmf (ECSt) using established spectroscopic methods .

    3. Controlled light fluctuation experiments: Subject plants to precisely controlled light regimes:

      • Sinusoidal light patterns with fluctuations

      • Step increases followed by steady-state periods

      • Light intensity ramps (e.g., starting at 39 μmol photons m−2 s−1 with programmed increases)

    4. Imaging-based approaches: Capture sequences of images with controlled timing (e.g., 60 ms delay between frames) during and after saturation flashes to visualize spatial heterogeneity in responses .

    5. Inhibitor studies: Apply specific inhibitors to manipulate components of the system:

      • Lincomycin (3 mM) to inhibit chloroplast protein translation

      • Uncouplers at low concentrations to partially dissipate pmf

      • Specific inhibitors of cyclic electron flow to alter pmf formation

    6. Correlation analysis: Establish statistical relationships between measured parameters:

      • QA redox state (qL) and photoinhibition (qI)

      • Light intensity and photoinhibition

      • Energy-dependent quenching (qE) and photoinhibition

    7. Genetic approaches: Compare wild-type O. pumila with mutants affected in pmf generation or utilization, or express O. pumila components in model organisms to assess their specific contributions.

    8. Thylakoid membrane analyses: Compare thylakoid lipid-per-chlorophyll ratios and membrane organization between species, as these factors influence proton movement and PSII repair processes .

    These approaches, used in combination, can reveal how O. pumila may have evolved to better manage the relationship between pmf and photoinhibition, potentially explaining its enhanced performance under stress conditions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.