Recombinant Oltmannsiellopsis viridis Apocytochrome f (petA)

Shipped with Ice Packs
In Stock

Description

Functional Role in Photosynthesis

The cytochrome b₆f complex, including petA, facilitates electron transfer and proton gradient generation essential for ATP synthesis. In Arabidopsis thaliana, nuclear mutations (e.g., hcf2) elevate petA transcript levels but impair electron transport, underscoring its regulatory complexity .

Key Findings:

  • Electron Transport: petA is indispensable for linking PSII and PSI activities.

  • Mutational Studies: Disrupted petA expression reduces PSII efficiency (Fv/Fm ratio) and net photosynthesis rates .

Production and Purification

The recombinant protein is optimized for stability and solubility:

  • Expression: Codon-optimized petA cloned into E. coli vectors.

  • Purification: Affinity chromatography via His-tag, followed by size-exclusion chromatography .

  • Storage: Lyophilized powder at -80°C; avoids repeated freeze-thaw cycles .

Research Applications

  1. Mechanistic Studies: Elucidate electron transport kinetics and complex assembly.

  2. Biotechnological Engineering: Optimize photosynthetic efficiency in crops.

  3. Structural Biology: Facilitate crystallization trials for 3D modeling (homology-based predictions currently used).

Comparative Analysis

FeatureO. viridis petAArabidopsis petA
Transcript RegulationStable under standard conditionsElevated in hcf2 mutants
Mutant PhenotypeNot characterizedChlorophyll deficiency, reduced PSII
Recombinant AvailabilityCommercially available Limited

Challenges and Future Directions

  • Functional Validation: In vitro reconstitution of the cytochrome b₆f complex using recombinant petA.

  • Editing Site Analysis: Explore RNA editing impacts on petA function, as seen in soybean chloroplasts .

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice is specifically requested. Advance notification is required for dry ice shipments, and additional charges will apply.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type is finalized during production. If a specific tag is required, please inform us, and we will prioritize its development.
Synonyms
petA; Cytochrome f
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
34-319
Protein Length
Full Length of Mature Protein
Species
Oltmannsiellopsis viridis (Marine flagellate) (Oltmannsiella viridis)
Target Names
petA
Target Protein Sequence
YPIFAQQNFKNPREANGRIVCANCHLAQKPVELEVPQAVLPDTVFEATVKVPYDKSIKQV GANGKPAELNVGAVLILPEGFQLAPSDRIPEEMKTKVGNLYFSPYSTEQKNILVVGPVPG KDYSEMVFPILSPDPAKDKSVSYLNYPVYLGGNRGRGQVYPDGSKSNNNVFGSPVAGTVS EIKALKSKKGGYEVTITTASGNTVVEKIPGGPEVIVSEGEVVTVDQPLTNNPNVGGFGQG EAELVLQNPARIQGLLLFLLATIGAQVFLVLKKKQFEKVQLAEMNF
Uniprot No.

Target Background

Function
Recombinant Oltmannsiellopsis viridis Apocytochrome f (petA) is a component of the cytochrome b6-f complex. This complex facilitates electron transfer between Photosystem II (PSII) and Photosystem I (PSI), cyclic electron flow around PSI, and state transitions.
Protein Families
Cytochrome f family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Single-pass membrane protein.

Q&A

What is Oltmannsiellopsis viridis and why is it significant in evolutionary studies?

Oltmannsiellopsis viridis is a marine flagellate belonging to the Ulvophyceae class within the phylum Chlorophyta (green algae). This organism has garnered significant scientific interest because it represents a distinct, early diverging lineage of the Ulvophyceae . Evolutionary researchers value O. viridis for its position in green algal phylogeny, particularly for understanding the divergence order of major green algal classes (Ulvophyceae, Trebouxiophyceae, and Chlorophyceae) .

The complete chloroplast genome of O. viridis has been sequenced and found to be 151,933 bp in length, containing 105 genes and featuring a distinctive quadripartite architecture that provides valuable insights into chloroplast genome evolution . Similarly, studies of mitochondrial DNA in this organism have contributed to understanding evolutionary trends in the Ulvophyceae . These genomic characteristics make O. viridis an excellent model for studying evolutionary relationships and genome reorganization events in green algae.

What expression systems and purification methods are recommended for recombinant Oltmannsiellopsis viridis Apocytochrome f?

Based on established protocols, the recommended expression system for recombinant O. viridis Apocytochrome f is E. coli . The expression construct typically includes an N-terminal His-tag to facilitate purification and detection . For optimal expression, researchers should consider the following methodology:

  • Expression vector selection: Using vectors with strong promoters (such as T7) and appropriate antibiotic resistance markers.

  • E. coli strain selection: BL21 strains are commonly used for protein expression as demonstrated in similar studies .

  • Culture conditions: Growth in LB media supplemented with appropriate antibiotics, induction with IPTG when OD600 reaches 0.6-0.8, followed by expression at lower temperatures (16-18°C) for 18-20 hours to enhance proper folding .

For purification, a multi-step approach similar to that used for other recombinant proteins is recommended:

  • Cell lysis using sonication in appropriate buffer (e.g., MES buffer pH 6.5 with EDTA and DTT)

  • Initial purification using Immobilized Metal Affinity Chromatography (IMAC) to capture the His-tagged protein

  • Additional purification steps such as ion exchange chromatography and size exclusion chromatography to achieve high purity

  • Quality assessment using SDS-PAGE and activity assays

This approach typically yields protein with greater than 90% purity, suitable for subsequent structural and functional studies .

What are the optimal storage conditions for maintaining the stability of recombinant Oltmannsiellopsis viridis Apocytochrome f?

To maintain the stability and activity of recombinant O. viridis Apocytochrome f, proper storage conditions are essential. Based on established protocols, researchers should adhere to the following guidelines:

  • Short-term storage: For working aliquots, store at 4°C for up to one week .

  • Long-term storage: Store at -20°C or preferably -80°C, with glycerol added to a final concentration of 30-50% to prevent freeze damage .

  • Lyophilization: The protein can be lyophilized and stored as a powder, which is particularly useful for long-term storage .

  • Reconstitution: When needed, reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL .

  • Aliquoting: Divide the protein solution into small working aliquots to avoid repeated freeze-thaw cycles, which can significantly reduce protein activity .

Storage ParameterRecommended Condition
Short-term storage4°C (up to one week)
Long-term storage-20°C/-80°C with 30-50% glycerol
Buffer compositionTris/PBS-based buffer, 6% Trehalose, pH 8.0
ReconstitutionDeionized sterile water (0.1-1.0 mg/mL)
Key precautionAvoid repeated freeze-thaw cycles

Researchers should also consider conducting stability studies under their specific laboratory conditions to optimize storage parameters for their particular experimental needs.

How can recombinant Oltmannsiellopsis viridis Apocytochrome f be used in evolutionary studies of green algae?

Recombinant O. viridis Apocytochrome f provides a valuable tool for evolutionary studies through several sophisticated approaches:

  • Comparative structural biology: By determining the structure of recombinant Apocytochrome f and comparing it with homologs from other algal classes, researchers can identify conserved domains and lineage-specific adaptations that reflect evolutionary history. This approach can utilize X-ray crystallography at multiple temperatures to capture conformational diversity .

  • Functional evolution analysis: Recombinant protein can be used in electron transfer assays to measure functional parameters across different species, providing insights into how electron transport function has evolved in different lineages.

  • Molecular clock applications: The petA gene and its protein product can serve as molecular markers in phylogenetic analyses. By comparing sequence and structural data from diverse green algal species, researchers can calibrate molecular clocks and estimate divergence times between major lineages.

  • Genome architecture studies: The petA gene organization in O. viridis provides insight into chloroplast genome evolution. The chloroplast genome of O. viridis shows distinctive quadripartite architecture with rRNA genes in the inverted repeat transcribed toward the single copy region . Combining genomic data with recombinant protein studies can elucidate how genome reorganization events affected protein evolution.

  • Experimental evolution approaches: Creating chimeric proteins combining domains from O. viridis with those from other species can test hypotheses about functional constraints and adaptations throughout evolutionary history.

This multi-faceted approach leverages the unique evolutionary position of O. viridis as a representative of an early-diverging lineage of Ulvophyceae, contributing to our understanding of green algal diversification and the evolution of photosynthetic mechanisms.

What considerations should guide experimental design for structural studies of Oltmannsiellopsis viridis Apocytochrome f?

When designing structural studies of O. viridis Apocytochrome f, researchers should consider multiple factors that can significantly impact results:

  • Temperature effects: Recent research highlights the importance of conducting structural studies at both cryogenic and room temperatures. Room temperature crystallography has revealed altered binding of small molecules compared to cryo conditions, with differences in binding poses, occupancy, and conformational responses . For Apocytochrome f, this suggests:

    • Conducting parallel studies at multiple temperatures

    • Analyzing temperature-dependent conformational changes that may reveal functional dynamics

    • Being cautious about interpreting binding studies performed only at cryogenic temperatures

  • Crystallization strategies: For membrane-associated proteins like Apocytochrome f:

    • Consider detergent screening to identify optimal conditions for protein stabilization

    • Explore lipidic cubic phase crystallization for membrane-spanning regions

    • Implement surface entropy reduction mutations to enhance crystallization propensity

    • Use nanobodies or crystallization chaperones to stabilize flexible regions

  • Complementary structural approaches: Beyond crystallography, consider:

    • Cryo-electron microscopy for visualizing the protein in different functional states

    • Small-angle X-ray scattering (SAXS) for solution-state conformational analysis

    • Nuclear magnetic resonance (NMR) spectroscopy for dynamics studies

    • Hydrogen-deuterium exchange mass spectrometry to probe conformational flexibility

  • Functional context: Design structural studies that capture the protein in physiologically relevant states:

    • Co-crystallization with natural binding partners

    • Analysis of redox-dependent structural changes using appropriate oxidizing/reducing conditions

    • Investigation of pH-dependent structural variations

These considerations will ensure that structural studies of O. viridis Apocytochrome f provide meaningful insights into the protein's function and evolution in photosynthetic electron transport systems.

How does Oltmannsiellopsis viridis petA compare to homologous genes in other green algae, and what implications does this have for experimental design?

Comparative analysis of O. viridis petA with homologs from other green algae reveals important evolutionary patterns that should inform experimental design:

  • Genomic context differences: In O. viridis, the chloroplast genome shows a unique quadripartite architecture that differs from other green algae . The genome encodes 105 genes, contains five group I introns, and features many short dispersed repeats . This genomic reorganization may have affected regulatory elements of petA, suggesting that experiments should:

    • Consider potential differences in expression regulation mechanisms

    • Examine the impact of surrounding genomic regions on gene expression

    • Investigate whether intron content differences affect processing of the gene transcript

  • Evolutionary position: O. viridis represents an early-diverging lineage of Ulvophyceae, with comparative genomic analyses supporting the notion that Ulvophyceae is sister to Chlorophyceae . This evolutionary positioning suggests:

    • Experiments comparing O. viridis petA with homologs from Chlorophyceae may reveal key evolutionary transitions

    • Functional studies might identify ancestral characteristics retained in O. viridis but lost in other lineages

    • Structural comparisons could pinpoint conserved domains essential for electron transport function

  • Nucleotide diversity patterns: Studies on mitochondrial and nuclear compartments in green algae indicate variation in selective constraints across different genomic regions . For petA research, this suggests:

    • Examining synonymous vs. non-synonymous substitution rates compared to other photosynthetic genes

    • Considering codon optimization when designing recombinant expression systems

    • Investigating whether selective pressures vary across different domains of the protein

  • Methodological implications:

    • Expression systems should be optimized specifically for the codon usage patterns of O. viridis

    • Purification strategies may need adjustments based on species-specific properties

    • When designing chimeric constructs or introducing mutations, researchers should consider the evolutionary distance between O. viridis and other green algae

By incorporating these evolutionary considerations into experimental design, researchers can develop more robust approaches to studying O. viridis petA and its role in photosynthetic electron transport.

What methodological approaches can resolve potential challenges in expression and purification of recombinant Oltmannsiellopsis viridis Apocytochrome f?

Expression and purification of membrane-associated proteins like Apocytochrome f present several challenges that require sophisticated methodological approaches to overcome:

  • Addressing insolubility issues:

    • Trial multiple E. coli expression strains (BL21, C41/C43, Arctic Express) that are optimized for membrane protein expression

    • Explore fusion partners beyond His-tag (MBP, SUMO, GST) that can enhance solubility

    • Implement a systematic optimization matrix varying induction temperature (15-30°C), inducer concentration (0.1-1.0 mM IPTG), and expression duration (4-24 hours)

    • Consider cell-free expression systems for difficult-to-express constructs

  • Optimizing protein folding:

    • Co-express with molecular chaperones (GroEL/GroES, DnaK/DnaJ) to assist proper folding

    • Include heme precursors in the growth medium to facilitate proper incorporation into the protein

    • Implement a systematic detergent screening approach using a panel of 10-12 detergents covering different classes (maltoside, glucoside, and phosphocholine-based)

  • Purification strategy refinement:

    • For initial capture, implement IMAC using Ni-NTA or cobalt resins with optimized imidazole gradient elution

    • Follow with ion exchange chromatography using SP FF cation exchange, as successful protein elution has been observed at approximately 200 mM NaCl

    • Complete purification with size exclusion chromatography using Superdex 75 in crystallization buffer (10 mM Tris pH 7.5, 0.2 mM EDTA, 25 mM NaCl, 3 mM DTT)

  • Protein quality assessment:

    • Implement thermal shift assays to evaluate protein stability under various buffer conditions

    • Utilize circular dichroism to confirm proper secondary structure formation

    • Assess heme incorporation using UV-visible spectroscopy and compare spectral characteristics with native cytochrome f

  • Stability enhancement strategies:

    • Identify and modify surface-exposed cysteine residues that might cause aggregation

    • Engineer constructs with varying N- and C-terminal boundaries to identify the minimal functional domain

    • Implement the addition of specific lipids or lipid-like molecules during purification to stabilize membrane-associated regions

ChallengeMethodological ApproachExpected Outcome
InsolubilityFusion partner screening, expression condition optimizationIncreased soluble protein yield
Improper foldingChaperone co-expression, heme supplementationEnhanced native conformation
Purification issuesMulti-step chromatography (IMAC, IEX, SEC)>90% purity suitable for structural studies
Stability concernsBuffer optimization, cysteine engineeringExtended protein shelf-life and activity

By systematically addressing these challenges, researchers can significantly improve the yield and quality of recombinant O. viridis Apocytochrome f for subsequent functional and structural studies.

How can temperature-dependent studies enhance our understanding of Oltmannsiellopsis viridis Apocytochrome f structure-function relationships?

Recent advances in room-temperature (RT) crystallography have revealed significant differences in protein-ligand interactions compared to traditional cryogenic studies . These findings have important implications for studying Apocytochrome f:

  • Conformational diversity detection:

    • RT crystallography can capture physiologically relevant conformational ensembles that may be "frozen out" in cryo conditions

    • For Apocytochrome f, this approach can reveal dynamic regions involved in electron transfer that might adopt a single conformation under cryogenic conditions

    • Multi-temperature crystallographic experiments (from cryo to physiological temperatures) can map the energy landscape of conformational states

  • Functional state characterization:

    • Temperature-dependent studies can reveal how the redox properties of Apocytochrome f change under different conditions

    • Electron transfer rates and mechanisms may differ significantly between cryogenic and room temperature measurements

    • Correlation of structural changes with functional parameters across temperature ranges can identify key determinants of electron transport efficiency

  • Experimental design considerations:

    • Implementation of both traditional harvested-crystal approaches and in situ crystallography methods to compare results

    • Data collection at multiple defined temperature points (100K, 240K, 280K, 310K) to map conformational transitions

    • Integration of solution-based spectroscopic methods (EPR, NMR) at corresponding temperatures to correlate with crystallographic observations

  • Methodological innovations:

    • Utilize fragment screening at multiple temperatures to identify potential binding sites that may only be accessible in physiologically relevant states

    • Apply PanDDA (Pan-Dataset Density Analysis) to detect low-occupancy binding events and conformational changes

    • Implement temperature as an experimental variable in molecular dynamics simulations to predict temperature-dependent behavior

The impact of these temperature-dependent approaches extends beyond structural characterization to inform protein engineering efforts, interaction studies with other components of the photosynthetic electron transport chain, and understanding evolutionary adaptations in different environmental niches.

What are the key specifications of commercially available recombinant Oltmannsiellopsis viridis Apocytochrome f?

For researchers planning experiments with recombinant O. viridis Apocytochrome f, understanding the technical specifications of commercially available products is essential:

ParameterSpecificationReference
Protein IdentityOltmannsiellopsis viridis Apocytochrome f (petA)
UniProt IDQ20EX6
Amino Acid Range34-319 (mature protein)
Molecular Weight~30 kDa (estimated)
Expression SystemE. coli
Fusion TagN-terminal His tag
Purity>90% by SDS-PAGE
FormulationLyophilized powder
Reconstitution SolutionDeionized sterile water
Recommended Concentration0.1-1.0 mg/mL
Storage BufferTris/PBS-based buffer, 6% Trehalose, pH 8.0
Storage Recommendation-20°C/-80°C with 30-50% glycerol for long-term

These specifications provide a baseline for researchers to design appropriate experimental protocols and ensure compatibility with their research systems. When designing experiments, researchers should consider these parameters alongside the specific requirements of their analytical techniques and biological questions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.