Recombinant Oltmannsiellopsis viridis ATP synthase subunit a, chloroplastic (atpI)

Shipped with Ice Packs
In Stock

Description

Production and Purification

This recombinant protein is commercially produced and optimized for stability:

  • Expression System: Typically expressed in E. coli or yeast systems .

  • Storage: Tris-based buffer with 50% glycerol; stable at -20°C or -80°C .

  • Purity: Verified via SDS-PAGE and Western blot .

Supplier Comparison

SupplierCatalog NumberQuantityPrice Range
MyBioSource.comMBS707502850 µg$400–$600
CUSABIO TECHNOLOGY LLCCSB-CF630304OAAD50 µg$350–$550

Functional Role in Chloroplast ATP Synthase

ATP synthase subunit a forms part of the membrane-embedded CF₀ subcomplex, enabling proton translocation across thylakoid membranes to drive ATP synthesis . Key insights:

  • Proton Channeling: Structural alignment with homologs suggests conserved acidic residues (e.g., Glu/Gln) mediate proton transport .

  • Regulatory Interactions: In Arabidopsis, the atpI gene is co-transcribed with atpH/F/A under the control of the SIG3 transcription factor, indicating conserved operon organization in green algae .

Biotechnological Relevance

  • Algal Engineering: Overexpression of ATP synthase subunits (e.g., AtpD in rice) enhances photosynthetic efficiency, suggesting potential for crop improvement .

  • Evolutionary Studies: Comparative genomics reveals atpI intron dynamics in green algae like Ulva, aiding phylogenetic analyses .

Challenges and Future Directions

  • Stability Issues: Repeated freeze-thaw cycles degrade the protein; single-use aliquots are recommended .

  • Functional Gaps: The exact role of Oltmannsiellopsis-specific residues (e.g., FYWNLGG motif) remains uncharacterized .

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format currently in stock. However, if you require a specific format, please indicate your preference in the order notes and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery times, please contact your local distributor.
Note: All protein shipments are standardly sent with blue ice packs. If dry ice packaging is required, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal stability, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers may use this as a reference.
Shelf Life
The shelf life of the protein is influenced by factors including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
Please note that the tag type will be finalized during the production process. If you have a specific tag type requirement, please inform us and we will prioritize developing the specified tag.
Synonyms
atpI; ATP synthase subunit a, chloroplastic; ATP synthase F0 sector subunit a; F-ATPase subunit IV
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-246
Protein Length
full length protein
Species
Oltmannsiellopsis viridis (Marine flagellate) (Oltmannsiella viridis)
Target Names
atpI
Target Protein Sequence
MLTMSTLVSNPLFELSEVSVGQHFYWNLGGNEVHGQVLLVSWFVLAVIIGFGLTANSNLK PTPDGLQNLSEYVTEFIRDLAKTQIGEEDYLSWVPFLGTIFLFVFVSNWSGALVPWALIE LPSGELAAPTNDINTTVALALLTSIAYFYAGINKKGLGYFKRYVEPAAFLLPINVLEDFT KPLSLSFRLFGNILADELVTGVLVALVPLVIPIPLMLLGLFTSAIQALVFSTLAGAYIGE SLEDHH
Uniprot No.

Target Background

Function
This protein plays a critical role as a key component of the proton channel. It directly facilitates the translocation of protons across the membrane.
Protein Families
ATPase A chain family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the structural composition and function of atpI in Oltmannsiellopsis viridis?

The ATP synthase subunit a, chloroplastic (atpI) in Oltmannsiellopsis viridis is a membrane protein component of the F0 sector of the ATP synthase complex. The full amino acid sequence consists of 246 amino acids with a molecular structure that includes multiple transmembrane domains designed to facilitate proton translocation across the thylakoid membrane. According to UniProt data (Q20EV6), the complete sequence includes regions rich in hydrophobic residues that anchor the protein within the membrane bilayer . The protein functions as part of the proton channel within the ATP synthase complex, facilitating the movement of protons down their electrochemical gradient which drives ATP synthesis.

The functional role of atpI involves:

  • Formation of the proton-conducting channel in the F0 sector

  • Interaction with the c-ring rotor to enable ATP synthesis

  • Maintenance of structural integrity of the ATP synthase complex

Studies on related ATP synthase components have shown that subunit a is essential for ATP synthesis through its role in proton translocation, although its specific function may vary slightly between species .

How is atpI conserved across green algal lineages?

The atpI gene shows remarkable conservation in terms of sequence and genomic context across various green algal lineages. Comparative genomic analyses have revealed that atpI typically occurs within conserved gene clusters in chloroplast genomes. In multiple species including Bryopsis hypnoides, the gene is found within the conserved cluster "rps2-atpI-atpH-atpF-atpA", indicating the evolutionary importance of this gene arrangement for chloroplast function .

Phylogenomic studies incorporating Oltmannsiellopsis viridis and other members of early-branching green algal lineages demonstrate that the atpI gene has maintained its essential function throughout evolutionary history. This conservation extends not only to the protein sequence but also to its position within the chloroplast genome, suggesting strong selective pressure to maintain both gene function and genomic architecture .

The conservation pattern indicates that atpI likely originated early in the evolution of green algae and has been maintained through vertical inheritance with minimal horizontal gene transfer, which is consistent with its essential role in chloroplast energy metabolism.

What experimental approaches are recommended for expression and purification of recombinant atpI?

For successful expression and purification of recombinant Oltmannsiellopsis viridis ATP synthase subunit a (atpI), researchers should consider the following methodological approach:

  • Expression System Selection: Due to the membrane-bound nature of atpI, an E. coli-based expression system with specialized features for membrane protein expression is recommended. The C41(DE3) or C43(DE3) strains, derivatives of BL21(DE3), are particularly suitable as they are adapted for membrane protein expression.

  • Vector Design: The expression construct should include:

    • A strong but inducible promoter (e.g., T7)

    • An appropriate tag for purification (His6 tag is commonly used)

    • A cleavage site for tag removal if needed for functional studies

    • Codon optimization for the expression host

  • Expression Conditions:

    • Lower induction temperatures (16-20°C) to allow proper membrane insertion

    • Lower IPTG concentrations (0.1-0.5 mM) to prevent formation of inclusion bodies

    • Extended expression times (16-24 hours) for optimal yields

  • Extraction and Purification:

    • Gentle cell lysis methods (French press or sonication with cooling)

    • Membrane fraction isolation via ultracentrifugation

    • Solubilization using mild detergents (DDM, LDAO, or C12E8)

    • Affinity chromatography followed by size exclusion chromatography

  • Storage Conditions:

    • Tris-based buffer with 50% glycerol at -20°C for extended storage

    • Storage of working aliquots at 4°C for up to one week

    • Avoidance of repeated freeze-thaw cycles

For quality control, it is essential to verify protein integrity using SDS-PAGE and Western blotting, and to assess protein folding using circular dichroism spectroscopy.

How does atpI interact with other ATP synthase components to facilitate complex assembly?

The assembly of functional ATP synthase complexes in chloroplasts involves intricate protein-protein interactions, with atpI playing a critical role. Evidence from bacterial systems indicates that AtpI functions as a chaperone-like protein during the assembly process, particularly in relation to c-ring formation. In studies of Bacillus pseudofirmus OF4, deletion of atpI led to reduced stability of the ATP synthase rotor, reduced membrane association of the F1 domain, and reduced ATPase activity, although the protein was not absolutely required for ATP synthase function .

Interaction studies should focus on the following methodological approaches:

  • Protein-Protein Interaction Analysis:

    • Co-immunoprecipitation with antibodies against atpI

    • Pull-down assays with tagged recombinant atpI

    • Crosslinking studies followed by mass spectrometry

    • Yeast two-hybrid or bacterial two-hybrid systems for specific interaction mapping

  • Temporal Assembly Studies:

    • Pulse-chase experiments to monitor incorporation of atpI into the complex

    • Time-course analysis of complex formation using blue native PAGE

    • Fluorescence resonance energy transfer (FRET) with fluorescently labeled subunits

The current evidence suggests that atpI interacts primarily with c-ring components during assembly, potentially serving as a scaffold for ring formation before dissociating from the completed complex. The reduced stability observed in atpI deletion mutants indicates that while not absolutely essential, atpI significantly enhances the efficiency and stability of the assembly process .

What is the relationship between atpI and RNA editing in chloroplasts?

RNA editing in chloroplasts predominantly involves the conversion of cytidine to uridine at specific sites, which can significantly alter gene expression and protein function. While atpI itself has not been directly implicated in RNA editing processes, research on other ATP synthase components provides insights into potential relationships.

Studies on the ATP synthase γ subunit ATPC1 in Arabidopsis have revealed unexpected roles in regulating RNA editing at multiple sites in plastid RNAs. Disruption of ATPC1 was shown to affect the editing efficiency at various sites, either increasing or decreasing editing depending on the specific site . This suggests a complex regulatory network where ATP synthase components may have dual functions in both energy production and RNA processing.

For researchers investigating potential roles of atpI in RNA editing, the following methodological approaches are recommended:

  • Editing Site Identification:

    • High-throughput RNA sequencing comparing genomic DNA and RNA sequences

    • Site-specific RNA editing analysis using poisoned primer extension

    • REDItools or similar computational pipelines for editing site detection

  • Functional Analysis:

    • Creation of atpI knockout or knockdown lines

    • Complementation studies with wild-type and mutant atpI

    • RNA editing factor (e.g., PPR proteins, MORFs) interaction studies

  • Mechanistic Studies:

    • RNA immunoprecipitation to identify direct RNA-protein interactions

    • In vitro editing assays with recombinant proteins

    • Structural studies of protein-RNA complexes

Given that ATP synthase components like ATPC1 have been shown to interact with RNA editing factors including MORFs, ORRM1, and OZ1, similar interactions involving atpI should be investigated .

How does the intron structure of atpI vary across species and what are the functional implications?

Intron structure analysis in atpI genes reveals fascinating evolutionary patterns with potential functional significance. In Avrainvillea mazei, a member of the Bryopsidales, the atpI gene contains introns that show remarkable sequence similarity to introns in other genes. Specifically, the atpI intron is virtually identical to the cysT intron for the first 518 bp and the last 90 bp, differing primarily by the presence of an open reading frame (ORF) in the atpI intron .

This finding suggests potential mechanisms of intron gain and evolution through duplication or transposition events. For researchers investigating atpI intron structure, the following methodological approaches are recommended:

  • Comparative Genomic Analysis:

    • Multi-species alignment of atpI gene sequences

    • Identification of conserved and variable intron positions

    • Phylogenetic analysis of intron gain and loss events

  • Intron Functionality Assessment:

    • RT-PCR analysis to confirm splicing efficiency

    • Investigation of alternative splicing patterns

    • Analysis of regulatory elements within intron sequences

  • Experimental Validation:

    • Construction of intron deletion or mutation variants

    • Chloroplast transformation with modified atpI genes

    • Splicing assays in heterologous systems

SpeciesatpI Intron StructureNotable FeaturesReference
Avrainvillea mazeiContains intron with ORFShares high similarity with cysT intron
Oltmannsiellopsis viridisNot fully characterizedLocated in conserved gene cluster
Bryopsis hypnoidesPart of conserved gene clusterNo intronic ORFs reported

The presence of ORFs within introns, as observed in A. mazei, suggests possible functional roles beyond mere splicing, including potential regulatory functions or mobile genetic element activity .

What techniques are most effective for studying atpI function in vivo?

Investigating atpI function in vivo requires approaches that can discern its role within the complex cellular environment of chloroplasts. The following methodological strategies are recommended:

  • Gene Disruption Approaches:

    • CRISPR-Cas9 targeted mutagenesis (where transformation protocols exist)

    • RNA interference for transient knockdown

    • Antisense RNA expression to reduce protein levels

    • Site-directed mutagenesis of conserved residues

  • Phenotypic Analysis:

    • Growth rate measurements under varying light and pH conditions

    • Chlorophyll fluorescence analysis (PAM fluorometry)

    • Oxygen evolution measurements

    • ATP/ADP ratio determination

  • Protein Localization and Assembly Studies:

    • Fluorescent protein tagging for in vivo localization

    • Blue native PAGE to assess complex integrity

    • Co-immunoprecipitation with other ATP synthase components

    • Electron microscopy of isolated chloroplasts

  • Physiological Measurements:

    • Proton gradient formation using pH-sensitive fluorescent dyes

    • Membrane potential measurements with potential-sensitive dyes

    • ATP synthesis rates under varying conditions

    • Chloroplast isolation and subfractionation

Studies on bacterial AtpI have shown that deletion mutants exhibit reduced stability of ATP synthase components and decreased ATPase activity while still maintaining basic functionality . Similar approaches could be applied to algal systems to determine the specific contributions of atpI to chloroplast ATP synthase function.

How can researchers effectively analyze the evolutionary relationships of atpI across algal lineages?

Phylogenomic analysis of atpI provides valuable insights into the evolutionary history of chloroplasts and photosynthetic organisms. For robust evolutionary analysis, researchers should employ the following methodological approaches:

  • Sequence Acquisition and Alignment:

    • Comprehensive sampling across diverse algal lineages

    • Extraction of atpI sequences from complete chloroplast genomes

    • Multiple sequence alignment using programs like MAFFT or MUSCLE

    • Manual curation of alignments to eliminate poorly aligned regions

  • Phylogenetic Analysis:

    • Maximum likelihood analysis with appropriate models (e.g., GTR+Γ for nucleotides, cpREV for amino acids)

    • Bayesian inference for posterior probability estimation

    • Gene tree-species tree reconciliation to identify discordance

    • Codon-based models to detect selection pressures

  • Outgroup Selection Strategy:

    • Strategic sampling of outgroups as demonstrated in Ostreobium studies

    • Multiple outgroup combinations to test robustness (e.g., Dasycladales, Ulvales-Ulotrichales, Chlorodendrophyceae, and Pedinophyceae)

    • Testing of alternative rooting positions

  • Analytical Considerations:

    • Partitioned analysis by codon position for nucleotide data

    • Amino acid versus nucleotide analysis comparison

    • Testing for compositional bias and heterotachy

    • Assessment of phylogenetic signal versus noise

Previous studies have demonstrated that careful outgroup selection and model choice significantly impact phylogenetic placement, particularly for early-branching lineages like Ostreobium . Similar considerations apply to evolutionary studies of atpI in Oltmannsiellopsis viridis.

How does atpI contribute to chloroplast development and function?

The ATP synthase subunit a (atpI) plays a crucial role in chloroplast development and function through its involvement in ATP synthesis and potentially other cellular processes. Evidence from studies on related ATP synthase components indicates that these proteins can have pleiotropic effects beyond their direct role in energy production.

Research on the ATP synthase γ subunit ATPC1 in Arabidopsis revealed that loss of function severely arrests chloroplast development, causing a pale-green phenotype and early seedling lethality . While direct evidence for atpI is more limited, its fundamental role in the ATP synthase complex suggests similar developmental importance.

For researchers investigating atpI's contribution to chloroplast development, these approaches are recommended:

  • Developmental Time-Course Analysis:

    • Examination of atpI expression during chloroplast biogenesis

    • Correlation of expression levels with developmental stages

    • Microscopic analysis of chloroplast ultrastructure in wild-type versus mutant lines

  • Transcriptome and Proteome Analysis:

    • RNA-seq to identify genes affected by atpI disruption

    • Differential proteomics to detect protein level changes

    • Analysis of specific chloroplast development marker genes

  • Physiological Assessment:

    • Measurement of photosynthetic parameters at different developmental stages

    • Analysis of thylakoid membrane organization

    • Assessment of chlorophyll synthesis and accumulation

Researchers should note that, as observed with ATPC1, the effects of atpI disruption likely extend beyond energy production to impact the expression of numerous chloroplast development-related genes .

What are the technical considerations for antibody development against Oltmannsiellopsis viridis atpI?

Developing specific antibodies against Oltmannsiellopsis viridis atpI presents several technical challenges due to the protein's hydrophobic nature and membrane localization. The following methodological approaches are recommended:

  • Epitope Selection:

    • Bioinformatic analysis to identify surface-exposed regions

    • Focus on hydrophilic loops between transmembrane domains

    • Selection of regions with low sequence similarity to other proteins

    • Consideration of the following peptide regions based on the amino acid sequence:

      • N-terminal region (amino acids 1-20)

      • Large hydrophilic loop regions (if present in the protein structure)

      • C-terminal region (amino acids 226-246)

  • Immunization Strategy:

    • Use of KLH-conjugated synthetic peptides representing selected epitopes

    • Recombinant expression of hydrophilic domains

    • Multiple immunization protocols with different adjuvants

    • Screening of multiple host animals for optimal immune response

  • Antibody Purification and Validation:

    • Affinity purification against the immunizing peptide or protein

    • Cross-absorption against related proteins to enhance specificity

    • Validation using multiple techniques:

      • Western blotting against native and recombinant proteins

      • Immunoprecipitation followed by mass spectrometry

      • Immunofluorescence microscopy to confirm localization

      • Negative controls using pre-immune serum and competing peptides

  • Optimization for Various Applications:

    • Determination of optimal antibody dilutions for different techniques

    • Assessment of antibody performance under various buffer conditions

    • Evaluation of fixation methods for immunohistochemistry

    • Testing of detergent compatibility for membrane protein detection

For researchers working with limited samples, a shotgun proteomic approach may be useful to confirm atpI detection before investing in custom antibody development.

What strategies can address poor expression yields of recombinant atpI?

Researchers frequently encounter challenges with the expression of membrane proteins like atpI. The following troubleshooting strategies can improve recombinant atpI yields:

  • Expression System Optimization:

    • Test multiple E. coli strains (BL21, C41/C43, Rosetta)

    • Consider eukaryotic expression systems for chloroplast proteins

    • Explore cell-free expression systems which can be advantageous for membrane proteins

    • Evaluate co-expression with chaperones (GroEL/GroES, DnaK/DnaJ)

  • Construct Design Improvements:

    • Optimize codon usage for the expression host

    • Try different fusion tags (MBP, SUMO, TrxA) known to enhance solubility

    • Test different promoter strengths and induction systems

    • Consider including native flanking sequences

  • Expression Condition Adjustments:

    • Reduce induction temperature to 16-20°C

    • Decrease inducer concentration

    • Extend expression time

    • Test different media formulations (TB, 2xYT, minimal media)

    • Supplement with specific lipids or membrane components

  • Extraction and Detection Enhancement:

    • Screen multiple detergents for optimal solubilization

    • Implement gentle lysis methods to preserve native structure

    • Use specialized resins for membrane protein purification

    • Optimize buffer components to stabilize the protein

If expression remains challenging, consider expressing only hydrophilic domains or using peptide synthesis for specific regions needed for functional studies or antibody production.

How can researchers address challenges in functional assays involving atpI?

Functional characterization of atpI presents unique challenges due to its integration within the multisubunit ATP synthase complex. The following methodological solutions are recommended:

  • Reconstitution Approaches:

    • Liposome reconstitution with purified components

    • Nanodiscs for stabilization of membrane proteins

    • Co-reconstitution with essential partner proteins

    • Use of native-like lipid compositions

  • Activity Assay Optimization:

    • ATPase activity measurements with coupled enzyme assays

    • Proton pumping assays using pH-sensitive fluorophores

    • Membrane potential measurements with potential-sensitive dyes

    • ATP synthesis assays under defined conditions

  • Control Development:

    • Generation of site-directed mutants as negative controls

    • Inclusion of specific inhibitors (oligomycin, DCCD) as controls

    • Comparison with related proteins from model organisms

    • Development of reconstituted systems with defined components

  • Troubleshooting Specific Issues:

    • For low activity: test different detergents and lipid compositions

    • For high background: implement additional purification steps

    • For inconsistent results: standardize protein:lipid ratios

    • For rapid inactivation: optimize buffer components and storage conditions

When standard approaches fail, consider indirect methods such as monitoring the effects of atpI variants on ATP synthase assembly or stability using techniques like blue native PAGE or analytical ultracentrifugation.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.