Recombinant Oltmannsiellopsis viridis ATP synthase subunit b, chloroplastic (atpF)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for fulfillment according to your requirements.
Lead Time
Delivery times vary depending on purchasing method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
atpF; ATP synthase subunit b, chloroplastic; ATP synthase F(0 sector subunit b; ATPase subunit I
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-183
Protein Length
full length protein
Species
Oltmannsiellopsis viridis (Marine flagellate) (Oltmannsiella viridis)
Target Names
atpF
Target Protein Sequence
METYMDTLNQLSTICFGHGDGFGINTNILETNIINLSVVIGVVVSFGGDALRSLLDNRKE TILANLQEADLRAKEAQEKLAAARLQLEQAQTKAQEIRQQGTITAEQEKQLCIKQAEADM ARLEDVKQQTLRLQQQRAMSQVSQQVIALALQKVRQKLQDAANSAFHTSVNNSNIAFFTK YKV
Uniprot No.

Target Background

Function

F1F0 ATP synthase synthesizes ATP from ADP in the presence of a proton or sodium gradient. This enzyme comprises two domains: the F1 domain, containing the extramembranous catalytic core, and the F0 domain, containing the membrane proton channel. These domains are linked by a central and a peripheral stalk. ATP synthesis in the F1 catalytic domain is coupled to proton translocation through a rotary mechanism involving the central stalk subunits.

This product is a component of the F0 channel and forms part of the peripheral stalk, connecting F1 to F0.

Protein Families
ATPase B chain family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Single-pass membrane protein.

Q&A

What is Oltmannsiellopsis viridis and why is its ATP synthase subunit b significant?

Oltmannsiellopsis viridis is a green alga belonging to the group of Chlorophytes. Its ATP synthase subunit b (encoded by the atpF gene) is particularly significant in understanding plastid evolution and function. This protein is a critical component of the chloroplastic ATP synthase complex, which plays a central role in the energetic processes of photosynthesis. The chloroplastic ATP synthase in O. viridis represents an important model for studying the distinctive properties of algal photosynthetic machinery compared to that of land plants .

The significance of this specific protein extends to evolutionary biology, as comparative studies between algal and embryophytic (land plant) plastid genomes reveal important differences in genetic control mechanisms that developed during the transition from aquatic to terrestrial environments . These differences may explain the varied functional capabilities observed between algal and land plant plastids, particularly in terms of adaptability and specialization.

How does the chloroplastic ATP synthase function in photosynthesis?

The chloroplastic ATP synthase, which includes the subunit b encoded by atpF, functions as a critical enzyme complex in the light-dependent reactions of photosynthesis. Located in the thylakoid membrane of the chloroplast, it utilizes the proton gradient generated during photosynthetic electron transport to synthesize ATP from ADP and inorganic phosphate.

The mechanism involves the flow of protons through the membrane-embedded portion of the ATP synthase (the Fo region, which includes subunit b), which drives the rotation of the central stalk. This rotation causes conformational changes in the catalytic sites located in the F1 portion, enabling ATP synthesis. In O. viridis, as in other photosynthetic organisms, this process is essential for converting light energy into chemical energy in the form of ATP, which powers various cellular processes including the Calvin cycle for carbon fixation .

What is the relationship between atpF and other components of the photosynthetic machinery?

The atpF gene product (ATP synthase subunit b) functions in close coordination with other components of the photosynthetic apparatus, particularly photosystem II (PSII) and the cytochrome b6f complex. These complexes work in sequence to generate the proton gradient that powers ATP synthase.

In the broader context of chloroplast function, the ATP synthase complex interacts with repair and maintenance systems that ensure photosynthetic efficiency. For example, research on sacoglossan slugs that incorporate algal chloroplasts (kleptoplasts) has shown that genes like ftsH, which encode proteins essential for the PSII repair cycle, are present in algal plastid genomes including that of O. viridis . These repair mechanisms are crucial for maintaining photosynthetic activity, especially under stress conditions where photodamage occurs. The continued function of ATP synthase depends on the proper maintenance of the entire photosynthetic apparatus, highlighting the interconnected nature of these systems.

How does the genetic control of O. viridis ATP synthase differ from that in land plants?

The genetic control of ATP synthase in O. viridis represents a fascinating case study in the evolution of plastid genome regulation. Comparative genomic analyses reveal that algal plastids, including those of O. viridis, retain more in situ control over their functions through plastid-encoded genes compared to land plants .

One significant difference is the presence of specific genes in algal plastid genomes that have been transferred to the nuclear genome in land plants through endosymbiotic gene transfer (EGT). This evolutionary process has resulted in a shift from in situ control to nuclear control over plastid function during the transition to land plants . As a consequence, the regulation of ATP synthase assembly and function in O. viridis likely relies more on plastid-encoded factors, whereas in land plants, nuclear-encoded proteins must be translated in the cytosol and post-translationally translocated to the plastid .

This distinction has profound implications for understanding the evolution of organellar integration and the increased complexity and versatility of land plant plastids, which can differentiate into a broader range of plastid types compared to algal plastids .

What methodological approaches are most effective for studying the function of recombinant O. viridis ATP synthase subunit b?

Investigating the function of recombinant O. viridis ATP synthase subunit b requires a multifaceted approach combining molecular biology, biochemistry, and biophysical techniques. Based on established research methodologies in the field, the following approaches are most effective:

  • Heterologous expression systems: Expression of the recombinant protein in model organisms such as E. coli or yeast, with appropriate modifications to ensure proper folding and post-translational modifications.

  • Purification protocols: Affinity chromatography using histidine tags, followed by size exclusion chromatography to obtain the purified protein for functional studies.

  • Reconstitution experiments: Incorporating the purified subunit b into liposomes or nanodiscs to study its membrane integration and interaction with other ATP synthase components.

  • Biophysical analyses: Techniques such as circular dichroism spectroscopy to examine secondary structure, and fluorescence resonance energy transfer (FRET) to study protein-protein interactions within the ATP synthase complex.

  • Site-directed mutagenesis: Creating targeted mutations to identify functionally important residues and domains within the protein.

For comprehensive functional characterization, these approaches should be complemented with comparative analyses between the recombinant protein and its native counterpart, as well as homologs from other species, to identify conserved and divergent functional properties .

How does the O. viridis ATP synthase subunit b contribute to kleptoplast longevity in sacoglossan slugs?

The relationship between O. viridis ATP synthase subunit b and kleptoplast function in sacoglossan slugs represents a complex and intriguing research question. Kleptoplasty refers to the phenomenon where certain sea slugs incorporate algal chloroplasts into their digestive cells, maintaining them in a functional state for extended periods.

Research suggests that the longevity of kleptoplasts may be influenced by the gene content of the algal plastid genome, including genes encoding components of ATP synthase. The presence of specific genes, such as ftsH (which encodes a protein essential for the photosystem II repair cycle), in the plastid genomes of algae like O. viridis might equip the stolen plastids with greater in situ control over photosystem maintenance .

Interestingly, comparative studies between short-term and long-term retaining sacoglossan species (Elysia cornigera and Elysia timida, respectively) have shown that the performance of kleptoplasts from the same algal source (Acetabularia acetabulum) is similar in both species, with carbon fixation declining at equal rates during starvation. This suggests that the differential survival rates of these slugs are not directly dependent on photosynthetic performance but rather on the animals' starvation tolerance mechanisms .

Protocol for expression and purification of recombinant O. viridis ATP synthase subunit b

The following protocol outlines a standardized approach for the expression and purification of recombinant O. viridis ATP synthase subunit b for functional studies:

  • Gene synthesis and cloning:

    • Optimize the atpF gene sequence for expression in the chosen host system

    • Clone into an expression vector with an appropriate promoter and affinity tag (e.g., pET vector with His-tag)

    • Transform into a competent E. coli strain (BL21(DE3) or similar)

  • Expression conditions:

    • Grow transformed cells in LB media with appropriate antibiotics at 37°C until OD600 reaches 0.6-0.8

    • Induce protein expression with IPTG (0.1-1.0 mM)

    • Continue incubation at lower temperature (16-20°C) for 16-20 hours

    • Harvest cells by centrifugation (5,000 × g, 15 min, 4°C)

  • Cell lysis and membrane fraction isolation:

    • Resuspend cell pellet in lysis buffer containing protease inhibitors

    • Disrupt cells using sonication or a cell disruptor

    • Remove cell debris by centrifugation (10,000 × g, 20 min, 4°C)

    • Isolate membrane fraction by ultracentrifugation (100,000 × g, 1 hour, 4°C)

  • Protein solubilization and purification:

    • Solubilize membrane pellet in buffer containing an appropriate detergent (e.g., n-dodecyl-β-D-maltoside)

    • Apply solubilized protein to Ni-NTA affinity column

    • Wash with buffer containing low imidazole concentration

    • Elute with buffer containing high imidazole concentration

    • Further purify by size exclusion chromatography

  • Quality assessment:

    • Analyze purity by SDS-PAGE and western blotting

    • Verify identity by mass spectrometry

    • Assess secondary structure by circular dichroism spectroscopy

This protocol can be adapted based on specific research requirements and the intended downstream applications of the purified protein.

Comparative analysis framework for ATP synthase function across species

To effectively compare the functional properties of O. viridis ATP synthase with those from other species, the following analytical framework is recommended:

Table 1: Comparative Analysis Framework for ATP Synthase Function

ParameterMethodologyData Analysis ApproachExpected Outcomes
ATP synthesis activityLuciferin-luciferase assayMichaelis-Menten kineticsKm, Vmax values for comparative efficiency
Proton translocation efficiencypH-sensitive fluorescent probesInitial rate measurementsProton/ATP ratios across species
Thermal stabilityDifferential scanning calorimetryTransition temperature analysisTm values indicating stability differences
Response to inhibitorsEnzyme activity assays with various inhibitorsIC50 determinationSensitivity profiles for different ATP synthases
Oligomerization statesBlue native PAGE, analytical ultracentrifugationDistribution analysis of oligomeric formsPreferred assembly states across species
Protein-protein interactionsCo-immunoprecipitation, crosslinking mass spectrometryInteraction network mappingSpecies-specific interaction patterns

When applying this framework, researchers should normalize experimental conditions across all species being compared and include appropriate controls to account for variations in protein preparation methods. The data generated should be statistically analyzed to identify significant differences in functional parameters, which can then be correlated with structural features and evolutionary relationships .

Evolutionary insights from O. viridis ATP synthase studies

Studies of O. viridis ATP synthase subunit b offer valuable insights into the evolutionary trajectory of photosynthetic organelles. The chloroplasts of green algae like O. viridis represent an intermediate stage in the evolutionary continuum from free-living cyanobacteria to the highly specialized plastids of land plants.

Comparative genomic analyses between O. viridis and other photosynthetic organisms have revealed distinctive patterns in gene content and control mechanisms. These patterns suggest a gradual shift from in situ control (within the plastid) to nuclear control over plastid function during the evolution of land plants . This evolutionary transition is particularly evident in the distribution of genes encoding components of the photosynthetic apparatus, including ATP synthase.

The presence of specific genes in the plastid genome of O. viridis that have been transferred to the nuclear genome in land plants provides evidence for the ongoing process of endosymbiotic gene transfer (EGT), a major driving force behind genome reduction in organelles . This process has profound implications for understanding how eukaryotic cells integrated and gained control over their endosymbionts, eventually transforming them into fully-fledged organelles.

Furthermore, studying the functional properties of O. viridis ATP synthase can illuminate adaptation mechanisms to different environmental conditions, as algal species have evolved diverse strategies for optimizing photosynthetic efficiency in aquatic environments.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.