Recombinant Oltmannsiellopsis viridis Cytochrome b6-f complex subunit 4 (petD)

Shipped with Ice Packs
In Stock

Description

General Information

Recombinant Oltmannsiellopsis viridis Cytochrome b6-f complex subunit 4 (petD) is a subunit of the cytochrome b6f complex found in the green alga Oltmannsiellopsis viridis . The cytochrome b6f complex is essential for photosynthetic electron transport in plants and cyanobacteria . The petD subunit is one of the eight subunits that make up the cytochrome b6f complex .

  • Other Names: Recombinant Oltmannsiellopsis viridis Cytochrome b6-f complex subunit 4 (petD)

  • CB Number: CB815631835

Function and Structure of the Cytochrome b6-f Complex

The cytochrome b6f complex mediates electron transfer between photosystems II and I in oxygenic photosynthesis . It is a dimer consisting of eight polypeptide subunits: cytochrome f (petA gene product), cytochrome b6 (PetB), Rieske iron-sulfur protein (PetC), subunit IV (PetD), and the small PetG, PetL, PetM, and PetN subunits . The four large subunits are responsible for organizing the electron transfer chain, while the functions of the four small subunits are not yet known, but they may provide structural support .

Role of PetD Subunit

The PetD subunit, also known as subunit IV, contains three transmembrane helices . PetD, along with cytochrome b6, forms a core sub-complex that initiates the assembly of the b6f complex . The loss of other small subunits, such as PetN or PetM, can destabilize the entire cytochrome b6f complex, highlighting the importance of these subunits in maintaining the complex's structural integrity and function .

Importance in Photosynthesis

The cytochrome b6f complex is crucial for both linear and cyclic electron transport in oxygenic photosynthesis . It links photosystems I and II, and its function is essential for the proper distribution of energy between the two photosystems .

Research on Cytochrome b6f Complex

Research has shown that the cytochrome b6f complex has unique structural and functional properties compared to the cytochrome bc1 complex, indicating that it is not just a modified version of the latter . Studies involving mutants lacking certain subunits, such as PetN, have demonstrated the importance of these subunits for the stability and activity of the complex .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline for your reference.
Shelf Life
Shelf life depends on various factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
petD; Cytochrome b6-f complex subunit 4; 17 kDa polypeptide
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-160
Protein Length
full length protein
Species
Oltmannsiellopsis viridis (Marine flagellate) (Oltmannsiella viridis)
Target Names
petD
Target Protein Sequence
MAVTKKPDLSDPVLRAKLAKGMGHNYYGEPAWPNDLLYMFPVVILGTFALSISLAVLAPA AMGEPANPFATPLEILPEWYFYPVFQILRVVPNKLLGVLCMAAVPVGLITVPFIESINKF QNPFRRPIASTLFLFGTATAVWLGIGAALPIDISLTLGLF
Uniprot No.

Target Background

Function
A component of the cytochrome b6-f complex. This complex facilitates electron transfer between photosystem II (PSII) and photosystem I (PSI), cyclic electron flow around PSI, and state transitions.
Protein Families
Cytochrome b family, PetD subfamily
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the structure and composition of the Cytochrome b6-f complex in Oltmannsiellopsis viridis?

The Cytochrome b6-f complex in Oltmannsiellopsis viridis, like in other photosynthetic organisms, is a multi-subunit protein complex essential for photosynthetic electron transport. The complex consists of several key components:

  • Cytochrome b6 (encoded by petB)

  • Subunit IV (encoded by petD) - a 17 kDa polypeptide

  • Cytochrome f (encoded by petA)

  • The Rieske protein (encoded by petC)

  • Four small polypeptides: PetG, PetL, PetM, and PetN

The petD protein specifically forms an integral part of this complex, with a full amino acid sequence length of 160 residues. The protein is characterized by several membrane-spanning domains that help anchor it within the thylakoid membrane where it functions in electron transport.

How does the gene organization of petD differ in Oltmannsiellopsis viridis compared to other green algae?

The petD gene in Oltmannsiellopsis viridis exhibits distinctive organizational features compared to other green algae:

SpeciesKey Organizational Features
Oltmannsiellopsis viridisThe psbB cluster is completely fractured; petD contains intron insertion at position 534
Ulva sp.petB contains intron insertion at position 69; different gene organization pattern
Bryopsis hypnoidesDifferent intron insertion patterns; no documented petD intron at position 534
Pseudendoclonium akinetumDifferent intron insertion patterns from O. viridis

This fractured arrangement of the psbB cluster in O. viridis represents a significant divergence from other green algal lineages, suggesting unique evolutionary pressures or events. The presence of specific intron insertion sites (especially at position 534 in petD) provides valuable phylogenetic markers for tracking evolutionary relationships among chlorophyte algae.

What are the functional roles of the Cytochrome b6-f complex in photosynthetic organisms?

The Cytochrome b6-f complex, of which petD is an essential component, performs several critical functions in photosynthetic organisms:

  • Linear electron transport: Facilitates electron transfer from Photosystem II (PSII) to Photosystem I (PSI)

  • Cyclic electron transport: Participates in cyclic electron flow around PSI, which generates ATP without producing NADPH

  • Regulatory functions: Involved in regulating gene expression in the chloroplast

  • Protein phosphorylation: Participates in reversible phosphorylation of plastid proteins, contributing to regulation of photosynthetic activity

  • Proton translocation: Helps establish a proton gradient across the thylakoid membrane that is essential for ATP synthesis

The complex serves as a molecular hub connecting the two photosystems and plays a crucial role in optimizing photosynthetic efficiency under varying environmental conditions.

What methodologies are most effective for studying petD gene expression in Oltmannsiellopsis viridis?

Studying petD gene expression in Oltmannsiellopsis viridis requires a combination of molecular and biochemical approaches:

DNA/RNA Extraction Protocol:

  • Collect and culture algal samples under controlled conditions (18°C, 100-120 μmol photons m⁻² s⁻¹, 12h light:12h dark cycle)

  • Extract high-quality DNA using plant genome DNA kits with modifications for algal cell walls

  • Verify DNA quality using spectrophotometry (NanoPhotometer) and fluorometry (Qubit 2.0)

Next-Generation Sequencing Approach:

  • Fragment DNA into ~350 bp fragments using sonication (e.g., Covaris S220)

  • Construct libraries for Illumina sequencing platforms

  • Generate paired-end reads (minimum 10 Gb of raw data)

  • Process data through quality control pipelines to remove adapters and low-quality reads

Chloroplast Genome Assembly:

  • Use specialized software like GetOrganelle v1.7.1 for plastome assembly

  • Employ reference-guided assembly using previously sequenced related species

  • Verify assembly using read mapping (BWA) and variant calling (VarScan)

  • Validate using visualization tools like IGV

Comparative Analysis:
Compare petD sequences and structures across multiple green algal species using maximum likelihood phylogenetic methods with appropriate substitution models (GTR+G for nucleotide sequences, cpREV+F+I+G4 for amino acid sequences) .

How do intron insertion patterns in petD and related genes differ across green algal lineages?

Intron insertion patterns in photosynthetic genes including petD show significant variation across green algal lineages, providing valuable phylogenetic information:

GeneInsertion SiteUlva sp.Pseudendoclonium akinetumOltmannsiellopsis viridisBryopsis hypnoides
petB692211---
petB534--1322-
petDVariousPresentPresentPresentVariable patterns
psbA525-12161127-
psbB6001306---

Research methodologies for studying these patterns include:

  • Comparative genomics approach: Use alignment of multiple chloroplast genomes to identify conserved and variable intron positions

  • Phylogenetic reconstruction: Apply maximum likelihood or Bayesian methods to determine evolutionary relationships based on intron presence/absence patterns

  • Boundary analysis: Identify precise intron-exon boundaries by aligning sequences with intronless homologs from related species

  • Motif identification: Perform BLAST analysis of intronic ORFs to identify conserved structural elements and potential endonuclease activities

These comparative analyses help reconstruct evolutionary histories and provide insights into the functional significance of intron acquisition or loss in photosynthetic genes.

What experimental challenges exist in expressing and purifying functional recombinant petD protein?

Expressing and purifying functional recombinant Oltmannsiellopsis viridis petD protein presents several significant challenges:

Membrane Protein Expression Challenges:

  • The hydrophobic nature of petD (as a membrane protein) makes heterologous expression difficult

  • Proper folding often requires specific lipid environments that may be lacking in common expression systems

  • The protein's integral membrane domains can lead to aggregation and inclusion body formation

Recommended Methodology for Expression:

  • Use specialized expression systems designed for membrane proteins (e.g., cell-free systems with added lipids)

  • Employ fusion tags that enhance solubility without compromising function

  • Consider expression in green algal systems that naturally contain the machinery for proper folding and assembly

Purification Protocol Considerations:

  • Store purified protein in optimized buffer containing 50% glycerol at -20°C for short-term or -80°C for extended storage

  • Avoid repeated freeze-thaw cycles, as indicated by product guidelines

  • For working with the protein, maintain aliquots at 4°C for up to one week

Quality Control:

  • Verify protein integrity through SDS-PAGE and Western blotting

  • Assess functionality through electron transport assays

  • Confirm proper folding using circular dichroism or other structural analysis methods

How can comparative genomic analysis of petD contribute to understanding chloroplast genome evolution?

Comparative genomic analysis of petD and related genes provides crucial insights into chloroplast genome evolution across green algal lineages:

Key Research Approaches:

  • Whole-genome comparison: Analyze complete chloroplast genomes from multiple species to identify gene rearrangements, expansions, and contractions

  • Selection pressure analysis: Determine patterns of purifying versus relaxed selection during secondary endosymbiosis events

  • Synteny analysis: Map gene order conservation/disruption to identify evolutionary breakpoints and constrained regions

Significant Findings from Current Research:

  • Secondary plastids have experienced temporary relaxation of purifying selection during secondary endosymbiosis

  • The petD gene, along with others like accD, shows variable patterns of retention or loss across green algal lineages, indicating differential selection pressures

  • In some lineages, there is evidence of genome reduction with tightly constrained patterns, suggesting functional optimization rather than random loss

Methodological Framework:

  • Employ maximum likelihood phylogenetic approaches with appropriate substitution models for nucleotide (GTR+G) and amino acid (cpREV+F+I+G4) datasets

  • Use ultrafast bootstrap analysis (1000 replicates) to assess branching confidence

  • Implement outgroup rooting with appropriate sister taxa to establish directionality of evolutionary changes

What role do PPR (Pentatricopeptide Repeat) proteins play in petD expression and function?

PPR (Pentatricopeptide Repeat) proteins play crucial roles in post-transcriptional regulation of organellar genes, including those encoding components of the cytochrome b6-f complex:

PPR Protein Distribution Across Green Algae:

GenusSpecies/StrainNumber of PPRsAverage repeat/protein
OstreococcusO. tauri178.0
OstreococcusO. lucimarinus208.1
OstreococcusO. sp. RCC809168.1
MicromonasM. pusilla CCMP1545187.2
MicromonasM. pusilla RCC299157.7
ChlorellaC. sp. NC64A257.4
CoccomyxaC. subellipsoidea C169198.8
VolvoxV. carteri107.8
ChlamydomonasC. reinhardtii147.0

Functional Significance:

  • PPR proteins are sequence-specific RNA-binding proteins that influence multiple aspects of RNA metabolism in chloroplasts

  • They can affect petD expression by mediating RNA splicing, stability, editing, or translation

  • Mutations in PPR proteins can lead to reduced accumulation of cytochrome b6-f complex

Research Methodologies:

  • Computational analysis: Identify and characterize PPR proteins in algal genomes through careful model validation and correction

  • Functional analysis: Generate knockout/knockdown mutants to assess effects on petD transcript processing and protein accumulation

  • RNA immunoprecipitation: Determine specific binding sites of PPR proteins on petD transcripts

  • Complementation studies: Test functional conservation of PPR proteins across species by cross-species gene transfer experiments

Understanding the relationship between PPR proteins and petD expression provides important insights into post-transcriptional regulation of photosynthetic apparatus assembly in green algae.

What are emerging research directions for Oltmannsiellopsis viridis petD studies?

Current research on Oltmannsiellopsis viridis petD is expanding in several promising directions:

  • Structural biology approaches: High-resolution structural studies of the cytochrome b6-f complex to elucidate species-specific features and functional adaptations

  • Synthetic biology applications: Engineering optimized versions of petD for enhanced photosynthetic efficiency in model organisms

  • Evolutionary genomics: Using petD as a marker for understanding chloroplast genome evolution and endosymbiotic events

  • Climate adaptation studies: Investigating how petD sequence and expression variations contribute to algal adaptation to changing environmental conditions

  • Biotechnological applications: Exploring potential uses of recombinant petD in biosensor development and photosynthesis-inspired artificial systems

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.