Recombinant Oltmannsiellopsis viridis Cytochrome b6 (petB)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order remarks for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
petB; Cytochrome b6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-215
Protein Length
full length protein
Species
Oltmannsiellopsis viridis (Marine flagellate) (Oltmannsiella viridis)
Target Names
petB
Target Protein Sequence
MSKVYEWFDERLELQAIADDVSSKYVPPHVNIFYCLGGITFTSFLVQVATGFAMTFYYRP TVAEAFASVQYIMTDVNFGWLIRSIHRWSASMMVMMMILHVFRVYLTGGFKRPRELTWVT GVIMAVCTVSFGVTGYSLPWDQVGYWAVKIVTGVPDAIPVVGAALVELLRGGVGVGQATL TRFYSLHTFVLPLATAVFMLAHFLMIRKQGISGPL
Uniprot No.

Target Background

Function
A component of the cytochrome b6-f complex, mediating electron transfer between photosystem II (PSII) and photosystem I (PSI), cyclic electron flow around PSI, and state transitions.
Protein Families
Cytochrome b family, PetB subfamily
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

How does O. viridis cytochrome b6 compare structurally with homologs from other photosynthetic organisms?

Cytochrome b6 from O. viridis shares considerable sequence homology with homologs from other photosynthetic organisms, including green algae, cyanobacteria, and higher plants. When comparing O. viridis cytochrome b6 with other species, researchers should examine:

OrganismMolecular WeightKey Structural DifferencesFunctional Implications
Oltmannsiellopsis viridis~24 kDaMarine adaptation featuresOptimized for marine environment
Arabidopsis thaliana~24 kDaStandard land plant structureReference model for higher plants
Chlamydomonas reinhardtii~24 kDaGreen algae model featuresFreshwater adaptation

The expected molecular weight of cytochrome b6 is approximately 24 kDa, consistent with observations in various photosynthetic species . Conservation analysis shows that transmembrane domains and heme-binding sites remain highly conserved across species, while surface-exposed regions show greater variability, suggesting evolutionary adaptation to different photosynthetic environments.

What are the optimal conditions for expressing recombinant O. viridis cytochrome b6 in heterologous systems?

Successful expression of recombinant O. viridis cytochrome b6 requires careful optimization of several parameters:

  • Expression System Selection: E. coli-based systems often yield sufficient quantities for biochemical studies, but eukaryotic systems may better facilitate proper folding and post-translational modifications. Consider using specialized E. coli strains designed for membrane protein expression.

  • Induction Parameters: For bacterial expression, IPTG concentrations between 0.1-0.5 mM with induction at lower temperatures (16-20°C) typically improve folding of membrane proteins like cytochrome b6.

  • Co-expression Strategies: Co-express with chaperones or heme biosynthesis components to improve proper incorporation of prosthetic groups essential for cytochrome b6 function.

  • Membrane Fraction Handling: Since cytochrome b6 is a thylakoid membrane protein, careful solubilization using appropriate detergents (such as n-dodecyl β-D-maltoside or digitonin) is critical for maintaining native structure .

  • Storage Conditions: Store purified protein in Tris-based buffer with 50% glycerol at -20°C or -80°C for extended storage, avoiding repeated freeze-thaw cycles to maintain activity .

How can researchers effectively detect and quantify recombinant O. viridis cytochrome b6 in experimental samples?

Detection and quantification of recombinant O. viridis cytochrome b6 can be achieved through several complementary techniques:

  • Western Blotting: Utilize anti-cytochrome b6 antibodies at dilutions of 1:1000-1:5000. For optimal results, denature samples at 75°C (not 95°C) for 5 minutes in standard Laemmli buffer and separate on 12% SDS-PAGE gels . Transfer conditions should be optimized for membrane proteins (30 minutes to PVDF membrane using wet transfer).

  • Blue Native PAGE: Particularly useful for studying cytochrome b6 in its native complex form, preserving protein-protein interactions within the cytb6/f complex .

  • Spectroscopic Analysis: Cytochrome b6 exhibits characteristic absorption spectra due to its heme groups. The reduced form shows distinctive peaks that can be used for identification and quantification.

  • ELISA Quantification: Commercial ELISA kits with recombinant O. viridis cytochrome b6 standards can provide sensitive quantification in complex samples .

  • Mass Spectrometry: For precise identification and characterization, LC-MS/MS analysis using tryptic digestion can identify signature peptides from the O. viridis cytochrome b6 sequence.

How can researchers investigate the integration of recombinant O. viridis cytochrome b6 into functional electron transport chains?

Investigating the integration and functionality of recombinant O. viridis cytochrome b6 in electron transport chains requires multiple analytical approaches:

  • Reconstitution Experiments: Incorporate purified recombinant cytochrome b6 into liposomes or nanodiscs along with other components of the electron transport chain to assess functional integration.

  • Electron Transport Assays: Measure electron transfer rates using artificial electron donors and acceptors specific to the cytb6/f complex. Common donor-acceptor pairs include plastoquinol analogs as donors and plastocyanin or cytochrome c as acceptors.

  • Proton Gradient Formation: Monitor proton pumping activity associated with functional cytochrome b6 using pH-sensitive fluorescent dyes or pH electrodes.

  • Mutagenesis Studies: Introduce site-specific mutations in conserved regions of the O. viridis cytochrome b6 sequence to identify critical residues for electron transport function. The highly conserved regions containing histidine residues that coordinate heme groups are particularly informative targets.

  • Cross-linking Analysis: Employ chemical cross-linking coupled with mass spectrometry to identify interaction partners and orientation within the thylakoid membrane.

What insights can comparative analysis of O. viridis cytochrome b6 provide for understanding adaptation to marine environments?

Oltmannsiellopsis viridis, as a marine flagellate, contains adaptations in its photosynthetic machinery that may provide valuable insights into marine environmental adaptation:

  • Salt Tolerance Mechanisms: Compare the surface charge distribution and ion-binding sites between O. viridis cytochrome b6 and freshwater/terrestrial homologs to identify adaptations for functioning in high-salt environments.

  • Light Harvesting Adaptations: Investigate whether the electron transport properties of O. viridis cytochrome b6 differ from terrestrial plants, potentially reflecting adaptation to the light spectrum available in marine environments.

  • Temperature Stability: Analyze thermal stability profiles of O. viridis cytochrome b6 compared to homologs from various ecological niches to identify adaptations for temperature fluctuations in marine environments.

  • Evolutionary Context: Phylogenetic analysis including cytochrome b6 sequences from diverse photosynthetic organisms can reveal evolutionary patterns specific to marine adaptation. The conservation of certain amino acid residues unique to marine species may indicate environmentally-driven selection.

  • Horizontal Gene Transfer: Investigate whether horizontal gene transfer events have influenced the evolution of cytochrome b6 in marine species like O. viridis, particularly by examining unusual sequence features not found in related lineages.

How is the petB gene organized in the O. viridis chloroplast genome compared to other algae?

The genomic organization of the petB gene in Oltmannsiellopsis viridis provides insights into the evolution of chloroplast genomes in green algae:

  • Location and Orientation: In most photosynthetic organisms, the petB gene is located within the chloroplast genome. In ulvophycean algae like O. viridis, the petB gene is typically contained within the large single-copy (LSC) region of the chloroplast genome.

  • Inverted Repeat Context: The chloroplast genomes of many algae, including ulvophyceans related to O. viridis, contain large inverted repeat (IR) sequences. While petB is not typically located within these IRs, the structure of these repeats influences genome stability and gene evolution .

  • Operonic Structure: In many algae, petB is often co-transcribed with other photosynthetic genes. The specific gene clustering pattern can provide insights into transcriptional regulation and evolutionary relationships.

  • Intron Presence/Absence: The presence or absence of introns in the petB gene varies across algal lineages and can inform evolutionary relationships. Comparative analysis of intron positions and sequences across species can reveal evolutionary patterns and potential horizontal gene transfer events.

  • Recombination Patterns: The chloroplast genomes of ulvophycean algae show evidence of various recombination events, which can impact the evolution of genes like petB. The flip-flop recombination observed between inverted repeats in some ulvophycean algae may help maintain gene complement and reduce illegitimate recombination .

What methodological approaches are recommended for studying the evolution of cytochrome b6 across diverse photosynthetic organisms?

To effectively study the evolution of cytochrome b6 across diverse photosynthetic lineages, researchers should employ multiple complementary approaches:

  • Sequence-Based Phylogenetics: Construct phylogenetic trees using both nucleotide and amino acid sequences of petB/cytochrome b6 from diverse photosynthetic organisms. Employ maximum likelihood, Bayesian inference, and distance-based methods to obtain robust evolutionary hypotheses.

  • Structure-Based Analysis: Map sequence conservation onto protein structural models to identify functionally constrained regions versus variable regions that may be involved in lineage-specific adaptations.

  • Synteny Analysis: Compare the genomic context surrounding the petB gene across species to identify conserved gene clusters and genomic rearrangements that may provide insights into evolutionary processes.

  • Selection Analysis: Employ tests for positive, negative, and relaxed selection on different branches of the cytochrome b6 phylogeny to identify lineages experiencing different selective pressures.

  • Ancestral Sequence Reconstruction: Infer ancestral cytochrome b6 sequences at key nodes in the phylogenetic tree to trace the historical sequence of mutations that led to extant diversity.

  • Experimental Validation: Express and characterize reconstructed ancestral sequences or representative sequences from diverse lineages to test hypotheses about functional evolution.

What are common challenges when working with recombinant O. viridis cytochrome b6 and how can researchers overcome them?

Working with recombinant membrane proteins like O. viridis cytochrome b6 presents several technical challenges:

  • Low Expression Yields:

    • Challenge: Membrane proteins often express poorly in heterologous systems.

    • Solution: Optimize codon usage for the expression host, use strong promoters specifically designed for membrane proteins, and consider fusion tags that enhance expression (such as MBP or SUMO).

  • Protein Aggregation:

    • Challenge: Cytochrome b6 may form aggregates during expression or purification.

    • Solution: Express at lower temperatures (16-20°C), use specialized detergents for membrane protein solubilization, and incorporate glycerol (up to 50%) in storage buffers to prevent aggregation .

  • Improper Heme Incorporation:

    • Challenge: Recombinant cytochrome b6 may lack proper incorporation of heme groups.

    • Solution: Supplement expression media with δ-aminolevulinic acid (ALA) to enhance heme biosynthesis, or co-express with heme lyase to improve incorporation.

  • Protein Degradation:

    • Challenge: Membrane proteins are often susceptible to proteolytic degradation.

    • Solution: Use protease-deficient expression strains, add protease inhibitors during purification, and store samples at -80°C with proper aliquoting to avoid freeze-thaw cycles .

  • Antibody Cross-reactivity:

    • Challenge: Antibodies may show cross-reactivity with homologous proteins.

    • Solution: Use peptide-specific antibodies targeting unique regions of O. viridis cytochrome b6. Commercial antibodies like AS18 4169 can detect cytochrome b6 from various species including algae, though specificity should be verified for O. viridis .

How can researchers troubleshoot inconsistent results in functional assays involving O. viridis cytochrome b6?

When encountering inconsistent results in functional assays with recombinant O. viridis cytochrome b6, consider these methodological approaches:

  • Protein Quality Assessment:

    • Verify protein integrity using SDS-PAGE and western blotting before functional assays.

    • Check spectroscopic properties to confirm proper heme incorporation.

    • Assess protein homogeneity using size exclusion chromatography or analytical ultracentrifugation.

  • Buffer Optimization:

    • Systematically test various buffer compositions, including different pH values (typically 7.0-8.0), salt concentrations, and additives.

    • For membrane proteins like cytochrome b6, detergent selection is critical; test multiple detergent types and concentrations.

  • Experimental Controls:

    • Include positive controls using well-characterized cytochrome b6 from model organisms like Arabidopsis thaliana.

    • Employ negative controls using denatured protein or samples lacking key components of the assay system.

    • Consider including internal standards to normalize between experimental runs.

  • Instrument Calibration and Standardization:

    • Ensure all instruments are properly calibrated before measurements.

    • Standardize assay conditions including temperature, incubation times, and reagent concentrations.

    • Document all experimental parameters meticulously to identify sources of variability.

  • Data Analysis Approaches:

    • Apply appropriate statistical methods to distinguish significant differences from experimental noise.

    • Consider using multivariate analysis when multiple parameters might affect results.

    • Validate findings using complementary methodological approaches.

How might CRISPR-Cas9 genome editing be applied to study O. viridis cytochrome b6 function in vivo?

CRISPR-Cas9 technology offers powerful approaches for investigating cytochrome b6 function directly in O. viridis or model algal systems:

  • Targeted Mutagenesis: Design guide RNAs targeting specific regions of the petB gene to introduce precise mutations that can help elucidate structure-function relationships in cytochrome b6. Key targets include conserved histidine residues involved in heme coordination and residues at putative quinol binding sites.

  • Knock-in Studies: Introduce epitope tags or fluorescent protein fusions to the endogenous petB gene to facilitate tracking of cytochrome b6 localization, turnover, and interactions without overexpression artifacts.

  • Promoter Modification: Modify the native promoter of petB to create conditional expression systems that allow controlled modulation of cytochrome b6 levels to study dosage effects on photosynthetic efficiency.

  • Orthogonal Studies: Replace the native O. viridis petB gene with orthologous genes from other species to investigate evolutionary adaptations through complementation studies.

  • High-throughput Screening: Develop CRISPR-based screens to identify genetic interactions with petB, potentially uncovering novel factors involved in cytochrome b6 assembly, regulation, or function.

What opportunities exist for applying recombinant O. viridis cytochrome b6 in synthetic biology approaches to photosynthesis enhancement?

Recombinant O. viridis cytochrome b6 offers several promising applications in synthetic biology approaches aimed at enhancing photosynthesis:

  • Engineered Electron Transport Chains: Incorporate O. viridis cytochrome b6 into synthetic electron transport chains designed to have altered redox properties or coupling efficiencies. Marine-adapted components may offer novel properties for engineered systems.

  • Hybrid Photosynthetic Complexes: Create hybrid cytb6/f complexes combining components from multiple species to optimize electron transfer rates or reduce susceptibility to photoinhibition.

  • Environmental Tolerance Engineering: Identify and transfer adaptive features from O. viridis cytochrome b6 to crop plants to enhance photosynthetic performance under stress conditions such as high salinity or temperature fluctuations.

  • Minimal Synthetic Photosystems: Incorporate O. viridis cytochrome b6 into minimal synthetic photosystems designed for specific biotechnological applications such as light-driven bioproduction of high-value compounds.

  • Biohybrid Energy Systems: Explore the integration of recombinant cytochrome b6 proteins into biohybrid devices for solar energy conversion, potentially leveraging the unique properties of marine-adapted variants for enhanced stability or performance.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.