Recombinant Oltmannsiellopsis viridis Photosystem Q (B) protein (psbA)

Shipped with Ice Packs
In Stock

Description

Applications in Research

This recombinant protein is primarily utilized for:

  • Herbicide resistance studies: PSII-targeting herbicides like DCMU bind to the D1 protein; recombinant psbA enables mechanistic investigations .

  • Photosynthesis optimization: Structural analyses of QB-binding dynamics in marine algae under varying light conditions .

  • Biotechnological engineering: Developing PSII variants with enhanced stress tolerance .

Table 2: Experimental Use Cases

ApplicationMethodologyOutcome Reference
Herbicide binding assaysCompetitive inhibition studies using flash-electrode O₂ measurements
Mutagenesis screensSite-directed mutagenesis to assess PSII electron transport kinetics
Structural biologyX-ray crystallography and cryo-EM of recombinant D1 complexes

Production and Stability

The protein is lyophilized for long-term storage at -20°C/-80°C, with reconstitution in Tris/PBS buffers recommended . Key stability considerations include:

  • Avoiding freeze-thaw cycles: Repeated thawing degrades the protein .

  • Glycerol addition: 50% glycerol enhances solubility and shelf life .

Comparative Analysis with Homologs

The O. viridis psbA shares functional motifs with homologs in Prorocentrum micans (UniProt Q9TM72) and diatoms, though marine species exhibit unique adaptations to high-salinity and low-light environments .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing the order, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery time information.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate with us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
psbA; Photosystem II protein D1; PSII D1 protein; Photosystem II Q(B protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-344
Protein Length
full length protein
Species
Oltmannsiellopsis viridis (Marine flagellate) (Oltmannsiella viridis)
Target Names
psbA
Target Protein Sequence
MTAILERREATSRWAQFCNWITSTENRLYIGWFGVIMIPCLLTATSVFIIAFIAAPPVDI DGIREPVSGSLLYGNNIISGAVIPTSNAIGLHFYPIWEAASLDEWLYNGGPYQLIVCHFL LGVACYMGREWELSFRLGMRPWIAVAYSAPVAAATAVFLIYPIGQGSFSDGMPLGISGTF NFMIVFQAEHNILMHPFHMLGVAGVFGGSLFSAMHGSLVTSSLIRETTENESANAGYKFG QEEETYNIVAAHGYFGRLIFQYASFNNSRSLHFFLAAWPVVGIWFTALGLSTMAFNLNGL NFNQSVVDSQGRVINTWADIINRANLGMEVMHERNAHNFPLDLA
Uniprot No.

Target Background

Function
Photosystem II (PSII) is a light-driven water:plastoquinone oxidoreductase that utilizes light energy to extract electrons from H₂O, generating O₂ and a proton gradient subsequently used for ATP formation. It comprises a core antenna complex responsible for photon capture and an electron transfer chain that converts photonic excitation into a charge separation. The D1/D2 (PsbA/PsbD) reaction center heterodimer binds P680, the primary electron donor of PSII, along with several subsequent electron acceptors.
Protein Families
Reaction center PufL/M/PsbA/D family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is Oltmannsiellopsis viridis and what is its taxonomic position?

Oltmannsiellopsis viridis is a marine unicellular green alga that exhibits a distinctive counterclockwise arrangement of basal bodies and a single cup-shaped chloroplast. Although previously classified within the Chlorophyceae, contemporary taxonomic classification positions it as the type species of the order Oltmannsiellopsidales within the Ulvophyceae .

Interestingly, recent phylogenetic analyses have challenged this classification. Multiple molecular studies consistently recover Oltmannsiellopsis in a well-supported clade with Tetraselmis (referred to as the "OT lineage") rather than with other ulvophycean algae . This phylogenetic position is recovered regardless of analytical method or dataset filtering, suggesting that the traditional classification of Oltmannsiellopsis as an ulvophyte may require reconsideration. Constraining Oltmannsiellopsis within a monophyletic Ulvophyceae results in significantly worse phylogenetic trees in AU tests, providing statistical support for its separation from other ulvophytes .

What are the characteristics of the Oltmannsiellopsis viridis chloroplast genome?

The complete chloroplast DNA (cpDNA) sequence of Oltmannsiellopsis viridis reveals several distinctive features that provide insights into chloroplast genome evolution within green algae. The genome exhibits a quadripartite architecture with an inverted repeat (IR) featuring an inverted rRNA operon .

Key characteristics of the Oltmannsiellopsis viridis chloroplast genome include:

FeatureMeasurement
Total Size151,933 bp
Inverted Repeat (IR)18,510 bp
Large Single Copy (LSC)33,610 bp
Small Single Copy (SSC)81,303 bp
A+T Content59.5%
Coding Sequences59.2%
Number of Genes105

The genome structure of Oltmannsiellopsis differs considerably from other chlorophyte cpDNAs in intron content and gene order but shares similarities with its ulvophyte relative Pseudendoclonium at the levels of quadripartite architecture, gene content, and gene density . One of the most notable structural features is that 52 genes that were typically found in the ancestral Large Single Copy (LSC) region have been transferred to the Small Single Copy (SSC) region, including 12 of those observed in Pseudendoclonium cpDNA .

How does the gene expansion in Oltmannsiellopsis viridis compare to other green algae?

Comparative analysis of gene expansions between Oltmannsiellopsis viridis and other green algae reveals interesting evolutionary patterns. Several genes in the Oltmannsiellopsis chloroplast genome are expanded relative to their counterparts in Mesostigma, an early-diverging charophyte green alga .

How can phylogenomic approaches enhance our understanding of Oltmannsiellopsis viridis evolution?

Phylogenomic approaches offer powerful tools for resolving the evolutionary history of Oltmannsiellopsis viridis and its relationship to other green algae. Current research employing these methods has already yielded important insights that challenge traditional taxonomic classifications.

Multiple phylogenetic analyses have consistently recovered Oltmannsiellopsis in a clade with Tetraselmis (the "OT lineage") rather than with other ulvophycean algae . This placement suggests a need to reconsider the taxonomic position of Oltmannsiellopsis within the green algal tree of life.

To further enhance our understanding, researchers should employ the following methodological approaches:

  • Multi-locus phylogenetic analyses: Expanding beyond plastid genes to include nuclear and mitochondrial markers would provide a more comprehensive evolutionary picture. This approach can help distinguish between organismal phylogeny and potential instances of horizontal gene transfer or endosymbiotic gene transfer.

  • Fast site removal techniques: As demonstrated in current research, removing the fastest-evolving sites from sequence alignments can improve phylogenetic signal-to-noise ratios. For optimal results, researchers should target alignments with average site rates in the 10^-0.5 to 10^-1.0 range, which have been shown to yield the highest bootstrap support values .

  • Statistical topology testing: Using tests such as the Approximately Unbiased (AU) test to evaluate alternative phylogenetic hypotheses provides rigorous statistical assessment. For example, existing research has shown that constraining Ulvophyceae as monophyletic (including Oltmannsiellopsis) results in significantly worse trees than unconstrained analyses .

What strategies are effective for expressing and purifying functional recombinant Oltmannsiellopsis viridis psbA protein?

Expressing and purifying functional membrane proteins like the psbA protein presents significant challenges due to their hydrophobic nature and complex folding requirements. For Oltmannsiellopsis viridis psbA, researchers should consider the following methodological strategies:

  • Expression system selection: While E. coli is often the first choice for recombinant protein expression, membrane proteins like psbA may benefit from eukaryotic expression systems such as yeast (Pichia pastoris) or insect cells (using baculovirus expression vectors). These systems provide a more suitable membrane environment for proper protein folding.

  • Fusion tag optimization: The addition of solubility-enhancing tags such as SUMO, MBP, or GST can improve expression levels and solubility. According to available product information, commercial recombinant Oltmannsiellopsis viridis psbA proteins are produced with tag types determined during the production process to optimize for the specific protein .

  • Membrane extraction and purification: For membrane proteins like psbA, detergent screening is crucial. A panel of detergents (e.g., DDM, LMNG, CHAPS) should be tested to identify optimal conditions for extracting the protein from membranes while maintaining its native structure. Subsequent purification can employ affinity chromatography, followed by size exclusion chromatography for final polishing.

  • Storage optimization: Commercial preparations of this protein are typically stored in Tris-based buffer with 50% glycerol . This high glycerol concentration helps maintain protein stability during freeze-thaw cycles. Researchers should aliquot the purified protein and store at -20°C or -80°C for extended storage, avoiding repeated freeze-thaw cycles.

How does the chloroplast genome architecture of Oltmannsiellopsis viridis inform our understanding of plastid genome evolution?

The chloroplast genome architecture of Oltmannsiellopsis viridis provides valuable insights into the evolution of plastid genomes in green algae. The Oltmannsiellopsis cpDNA features a quadripartite structure with an inverted repeat (IR) containing inverted rRNA operons, which represents a significant deviation from the ancestral chloroplast genome architecture .

One of the most notable evolutionary events revealed by the Oltmannsiellopsis genome is the large-scale transfer of genes between genomic regions. Specifically, 52 genes that were located in the ancestral Large Single Copy (LSC) region have been transferred to the Small Single Copy (SSC) region . This extensive reorganization suggests that major structural rearrangements have occurred during the evolution of chloroplast genomes in the ulvophycean lineage.

To further investigate plastid genome evolution, researchers should employ the following approaches:

  • Synteny analysis: Comparing gene order and genomic rearrangements across diverse green algal lineages can reveal patterns of genome evolution and identify potential mechanisms of structural change.

  • Selection pressure analysis: Examining the ratio of synonymous to non-synonymous substitutions (dN/dS) in plastid genes can help identify genes under positive, negative, or relaxed selection in different lineages.

  • Repeat sequence analysis: The presence and distribution of repeat sequences often correlate with genomic rearrangements. Detailed analysis of repeats in Oltmannsiellopsis and related species could provide insights into the mechanisms driving chloroplast genome restructuring.

What experimental approaches can reveal the role of Oltmannsiellopsis viridis psbA in photoinhibition mechanisms?

Photoinhibition, the light-induced damage to the photosynthetic apparatus, particularly affects the psbA (D1) protein, which undergoes rapid turnover under high light conditions. To investigate the role of Oltmannsiellopsis viridis psbA in photoinhibition mechanisms, researchers should consider the following experimental approaches:

How can researchers investigate gene expression regulation of psbA in Oltmannsiellopsis viridis?

Understanding the regulation of psbA gene expression in Oltmannsiellopsis viridis requires a comprehensive approach combining molecular, cellular, and bioinformatic techniques:

  • Transcriptomic analysis: Perform RNA-seq under various environmental conditions (different light intensities, nutrient levels, temperatures) to quantify psbA transcript abundance. This approach can identify conditions that trigger changes in gene expression and reveal co-regulated genes.

  • Promoter analysis: Clone the promoter region of the psbA gene from the Oltmannsiellopsis viridis chloroplast genome and fuse it to reporter genes. This construct can be used in transient expression assays to identify cis-regulatory elements involved in transcriptional control.

  • RNA stability studies: Measure psbA mRNA half-life under different conditions using transcription inhibitors followed by quantitative RT-PCR. Changes in mRNA stability can be a significant post-transcriptional regulatory mechanism for chloroplast genes.

  • Polysome profiling: Analyze the association of psbA transcripts with ribosomes under different conditions to assess translational regulation, which is known to be important for chloroplast gene expression in many photosynthetic organisms.

  • Chromatin immunoprecipitation (ChIP): If nuclear factors regulate chloroplast gene expression in Oltmannsiellopsis (as in some other algae), ChIP experiments can identify proteins binding to the psbA promoter or other regulatory regions.

  • Comparative genomic analysis: Compare the psbA gene and its flanking regions across green algal lineages to identify conserved regulatory elements. The position of psbA within the genome context may also provide clues about its regulation, particularly in light of the unusual quadripartite structure of the Oltmannsiellopsis chloroplast genome .

How can structural studies of Oltmannsiellopsis viridis psbA inform herbicide resistance mechanisms?

The D1 protein (psbA) is the target of many commercially important herbicides that inhibit photosynthesis. Structural studies of Oltmannsiellopsis viridis psbA can provide valuable insights into herbicide binding and resistance mechanisms through the following approaches:

  • Homology modeling and molecular docking: Using the complete amino acid sequence of Oltmannsiellopsis viridis psbA , researchers can build homology models based on existing crystal structures of photosystem II complexes. These models can be used for in silico docking studies with various herbicides to predict binding modes and affinities.

  • Identification of resistance-conferring mutations: By comparing the Oltmannsiellopsis viridis psbA sequence with those of herbicide-resistant strains from other species, researchers can identify potential resistance-conferring mutations. These sites can then be targeted for mutagenesis studies to validate their role in herbicide binding.

  • Structural analysis of the QB binding pocket: The psbA protein forms the QB binding pocket, which is the target site for many herbicides. Detailed structural analysis of this region in Oltmannsiellopsis viridis psbA can reveal species-specific features that might influence herbicide sensitivity or resistance.

  • Crystallization with bound herbicides: Although challenging, obtaining crystal structures of the psbA protein in complex with various herbicides would provide definitive information about binding interactions and resistance mechanisms. The recombinant protein preparation methods described earlier could be adapted to produce protein for crystallization trials.

What insights can Oltmannsiellopsis viridis provide into the evolution of photosynthesis among green algae?

Oltmannsiellopsis viridis occupies a unique phylogenetic position that makes it valuable for understanding photosynthesis evolution in green algae. Its unusual placement in the "OT lineage" with Tetraselmis rather than with other ulvophytes offers opportunities to study convergent and divergent evolution of photosynthetic mechanisms.

Research approaches to leverage this evolutionary context include:

  • Comparative genomic analysis: Compare the photosynthetic gene complement and organization in Oltmannsiellopsis with those of algae from different lineages, including Tetraselmis (its close relative), other ulvophytes, trebouxiophytes, and chlorophytes. The unusual chloroplast genome architecture of Oltmannsiellopsis may reflect unique evolutionary pressures on its photosynthetic machinery.

  • Ancestral state reconstruction: Using phylogenomic datasets that accurately place Oltmannsiellopsis in the green algal tree , perform ancestral state reconstruction analyses to infer the photosynthetic characteristics of ancestral nodes and trace the evolution of key photosynthetic traits.

  • Molecular clock analyses: Dating the divergence of Oltmannsiellopsis and related lineages can provide a temporal framework for understanding the evolution of photosynthetic innovations in green algae.

  • Functional comparison of photosynthetic proteins: Comparative biochemical and biophysical studies of recombinant photosynthetic proteins, including psbA, from Oltmannsiellopsis and other strategically selected green algae can reveal functional adaptations that have occurred during evolution.

  • Transcriptomic and proteomic responses to environmental conditions: Comparing how Oltmannsiellopsis and other green algae regulate their photosynthetic machinery in response to various environmental stressors can reveal lineage-specific adaptations and conserved response mechanisms.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.