Recombinant Oncopeltus fasciatus Cytochrome c oxidase subunit 2 (COII)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Oncopeltus fasciatus Cytochrome c Oxidase Subunit 2 (COII)

Recombinant Oncopeltus fasciatus Cytochrome c Oxidase Subunit 2 (COII) is a protein expressed in E. coli and tagged with N-terminal His. It is derived from the large milkweed bug, Oncopeltus fasciatus . Cytochrome c oxidase subunit 2 (COII) is a highly conserved protein that facilitates the transfer of electrons from cytochrome c to cytochrome c oxidase (COX), which is essential for ATP production during cellular respiration .

Characteristics

CharacteristicDescription
SpeciesOncopeltus fasciatus (Large milkweed bug)
SourceE. coli
TagHis
Protein LengthFull Length (1-229 aa)
FormLyophilized powder
AA SequenceMATWMNINLQDANSSTMEQLTMFHDHTLMILTMITSIVTFIMVSMTTNTLINRYLLEGQTIEFIWTTIPAITLIFIALPSLHLLYLIDEINNPEMTLKVIGHQWYWSYEYSDFKNIEFD SYMKPTNELMNNEFRLLEVDNRVLLPMNKQIRILITAADVLHSWAIPSLGVKIDATPGRLNQGSIKINRPGILFGQCSEICGANHSFMPIVIESVPIKNFLKWINKSLSS
PurityGreater than 90% as determined by SDS-PAGE
ApplicationsSDS-PAGE
StorageStore at -20°C/-80°C upon receipt, aliquoting is necessary for multiple use. Avoid repeated freeze-thaw cycles .
Storage BufferTris/PBS-based buffer, 6% Trehalose, pH 8.0
ReconstitutionReconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL. Recommend adding 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃ .
Gene NameCOII
SynonymsCOII; Cytochrome c oxidase subunit 2; Cytochrome c oxidase polypeptide II
UniProt IDP29876

Function and Significance

The COII protein is crucial for cellular respiration, acting as a key component in the electron transport chain . Studies on COII in insects like Oncopeltus fasciatus contribute to understanding molecular evolution and the functional consequences of genetic variation in essential metabolic enzymes .

Applications in Research

  • Protein Studies: Recombinant COII can be utilized in SDS-PAGE for protein analysis .

  • Evolutionary Biology: The COII gene is valuable for studying molecular evolution and adaptation in various species .

  • Insect Physiology: Oncopeltus fasciatus is used as a model organism in evo-devo research, offering insights into developmental and evolutionary biology .

  • Gene Expression Analysis: Employed in quantitative real-time PCR (qRT-PCR) to determine gene expression levels .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is finalized during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
COII; Cytochrome c oxidase subunit 2; Cytochrome c oxidase polypeptide II
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-229
Protein Length
full length protein
Species
Oncopeltus fasciatus (Large milkweed bug)
Target Names
COII
Target Protein Sequence
MATWMNINLQDANSSTMEQLTMFHDHTLMILTMITSIVTFIMVSMTTNTLINRYLLEGQT IEFIWTTIPAITLIFIALPSLHLLYLIDEINNPEMTLKVIGHQWYWSYEYSDFKNIEFDS YMKPTNELMNNEFRLLEVDNRVLLPMNKQIRILITAADVLHSWAIPSLGVKIDATPGRLN QGSIKINRPGILFGQCSEICGANHSFMPIVIESVPIKNFLKWINKSLSS
Uniprot No.

Target Background

Function
Recombinant *Oncopeltus fasciatus* Cytochrome c oxidase subunit 2 (COII) is a component of cytochrome c oxidase (Complex IV), the terminal enzyme in the mitochondrial electron transport chain. This chain, comprising succinate dehydrogenase (Complex II), ubiquinol-cytochrome c oxidoreductase (Complex III), and cytochrome c oxidase, facilitates electron transfer from NADH and succinate to molecular oxygen. This process generates an electrochemical gradient across the inner mitochondrial membrane, driving ATP synthesis. Cytochrome c oxidase catalyzes the reduction of oxygen to water. Electrons from reduced cytochrome c in the intermembrane space are transferred through the CuA center of subunit 2 and heme A of subunit 1 to the binuclear center (heme A3 and CuB) in subunit 1. Here, molecular oxygen is reduced to two water molecules using four electrons from cytochrome c and four protons from the mitochondrial matrix.
Protein Families
Cytochrome c oxidase subunit 2 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is the significance of studying COII in Oncopeltus fasciatus compared to other insect models?

Oncopeltus fasciatus (milkweed bug) presents unique advantages as a research model for COII studies. As a hemimetabolous insect with a 60+ year history as a laboratory organism, it serves as an excellent comparative model against holometabolous insects while remaining experimentally tractable . Unlike many pest hemipterans that share similar piercing-sucking mouthparts, O. fasciatus is amenable to functional investigations through RNA interference (RNAi), making it valuable for comparative genomic studies . Its COII gene, encoding a critical component of the mitochondrial electron transport chain, provides insights into metabolic adaptation and evolutionary relationships while benefiting from the recently sequenced genome .

What are the recommended protocols for isolating high-quality mitochondrial DNA from Oncopeltus fasciatus for COII amplification?

For optimal mitochondrial DNA isolation from O. fasciatus:

  • Tissue preparation: Fresh tissue (preferably thoracic muscle) should be dissected from 3-5 adult specimens maintained in laboratory colonies at 26-28°C with 60% humidity.

  • Homogenization protocol:

    • Homogenize tissue in isolation buffer (225 mM mannitol, 75 mM sucrose, 10 mM MOPS, 1 mM EGTA, pH 7.2)

    • Centrifuge at 600g for 10 minutes to remove nuclei and debris

    • Collect supernatant and centrifuge at 10,000g for 15 minutes to pellet mitochondria

  • DNA extraction: Extract mtDNA using a modified phenol-chloroform method or commercial mitochondrial DNA isolation kits.

  • Quality considerations: Freshness of specimens is critical; degraded samples will yield fragmented mtDNA unsuitable for long-range PCR of the COII gene.

  • PCR optimization: Use conserved Hemiptera-specific primers with touchdown PCR protocols to improve specificity, particularly important when working with the A+T rich insect mitochondrial genome.

How do researchers typically clone the COII gene from Oncopeltus fasciatus for recombinant expression?

The standard workflow for COII cloning from O. fasciatus involves:

  • Primer design considerations:

    • Design primers based on the O. fasciatus genome sequence

    • Include appropriate restriction sites for downstream cloning

    • Consider codon optimization for the target expression system

  • PCR amplification strategy:

    • Use high-fidelity polymerase to minimize mutation introduction

    • Implement a touchdown PCR protocol (initial denaturation at 95°C for 3 min; 10 cycles of 95°C for 30s, 62°C-52°C for 30s, 72°C for 1 min; 25 cycles of 95°C for 30s, 52°C for 30s, 72°C for 1 min)

  • Molecular cloning approach:

    • Clone amplified COII into an intermediate vector (pGEM-T Easy) for sequence verification

    • Subclone into the appropriate expression vector with affinity tags (usually 6xHis or GST)

    • Verify the construct by sequencing before proceeding to expression

  • Codon optimization considerations: Insect mitochondrial genes use a different genetic code than the standard code, necessitating careful consideration when expressing in bacterial systems.

What expression systems are most effective for producing functional recombinant Oncopeltus fasciatus COII?

Expression SystemAdvantagesLimitationsOptimization Strategies
E. coliHigh yield, rapid growth, cost-effectivePotential inclusion body formation, lack of PTMsUse specialized strains (Rosetta, C41/C43); lower induction temperature (16-18°C)
Insect cells (Sf9, Sf21)Native-like PTMs, proper foldingHigher cost, slower growthOptimize MOI (0.5-5), harvest time (48-72h post-infection)
Yeast (P. pastoris)High yield, eukaryotic PTMsLonger development timeOptimize methanol induction protocol
Cell-free systemsAvoids toxicity issues, rapidLower yield, higher costSupplement with chaperones and membrane mimetics

What purification strategies yield the highest purity recombinant COII from Oncopeltus fasciatus?

Purifying recombinant COII requires specialized approaches due to its membrane-bound nature:

  • Membrane extraction protocol:

    • Perform cell lysis in buffer containing 50 mM Tris-HCl pH 8.0, 150 mM NaCl, 1 mM EDTA, protease inhibitors

    • Isolate membrane fraction by ultracentrifugation (100,000g for 1 hour)

    • Solubilize membranes with mild detergents (1% DDM, 1% LMNG, or 1% digitonin)

  • Affinity chromatography optimization:

    • For His-tagged constructs: Use IMAC with 5 mM imidazole in wash buffer and 250 mM imidazole for elution, maintaining detergent above CMC throughout

    • For GST-tagged constructs: Use glutathione-agarose with cleavable linkers

  • Secondary purification steps:

    • Size exclusion chromatography in buffer containing 0.05% DDM, 150 mM NaCl, 20 mM HEPES pH 7.5

    • Ion exchange chromatography if additional purity is required

  • Storage considerations: Store in buffer containing 10% glycerol at -80°C to maintain activity.

How can CRISPR/Cas9 genome editing be optimized for studying COII function in Oncopeltus fasciatus?

CRISPR/Cas9 has been successfully implemented in O. fasciatus, demonstrating high efficiency of mutagenesis as evidenced by studies targeting the white gene . For COII editing:

  • Guide RNA design considerations:

    • Select target sites with minimal off-target potential using tools adapted for hemipteran genomes

    • Design gRNAs targeting exonic regions with high conservation

    • Implement dual-gRNA approaches for increased efficiency

  • Delivery protocol optimization:

    • Microinject Cas9 protein (500 ng/μl) with gRNAs (100 ng/μl each) into embryos 0-2 hours AEL

    • Maintain consistent injection volume (approximately 10% of embryo volume)

    • Allow development at 26-28°C with 60-70% humidity

  • Screening methodology:

    • Implement T7 endonuclease assay or heteroduplex mobility assay for initial mutation detection

    • Use deep sequencing to characterize the mutation spectrum

    • Establish crosses to identify germline transmission rates

  • Phenotypic analysis approach:

    • Complete knockout of COII is likely lethal; therefore, employ conditional or tissue-specific strategies

    • Use RNAi in conjunction with CRISPR to validate phenotypes and rule out off-target effects

    • Implement egg injection and maternal RNAi approaches as shown effective in O. fasciatus

The high efficiency of CRISPR/Cas9 observed in O. fasciatus (with biallelic mutations in the G0 generation when targeting the white gene ) suggests this approach would be effective for studying COII function, though lethality considerations will necessitate careful experimental design.

What are the methodological considerations for using recombinant Oncopeltus fasciatus COII in structural studies?

Structural characterization of recombinant O. fasciatus COII presents unique challenges:

  • Sample preparation for crystallography:

    • Obtain protein at >95% purity and 5-10 mg/ml concentration in detergent micelles

    • Screen detergents systematically (DDM, LMNG, C12E8, CYMAL-6)

    • Implement lipidic cubic phase crystallization for improved crystal formation

  • Cryo-EM considerations:

    • Use amphipol A8-35 or nanodisc reconstitution to improve particle distribution

    • Optimize protein concentration to 0.5-2 mg/ml

    • Screen grid types and blotting conditions extensively

  • NMR approaches:

    • Express protein with 15N and 13C labeling in insect cells using labeled amino acids

    • Reconstitute in bicelles or nanodiscs for solution NMR

    • Focus on specific domains or use selective labeling strategies

  • Computational modeling integration:

    • Use the O. fasciatus genome sequence data to inform structural predictions

    • Implement homology modeling against better-characterized insect COII structures

    • Validate models with limited experimental data such as cross-linking or EPR

Structure Determination MethodResolution RangeSample RequirementsKey Advantages
X-ray Crystallography1.5-3.5 Å5-10 mg/ml, highly pureHighest potential resolution
Single-particle Cryo-EM2.5-4.0 Å0.5-2 mg/ml, moderate purityNo crystals needed
Solid-state NMR3.0-15 ÅIsotope-labeled, 5-20 mgDynamic information
Computational ModelingVariableSequence dataRapid, low cost

How can recombinant COII be leveraged to study mitochondrial dysfunction in Oncopeltus fasciatus development?

Recombinant COII provides powerful tools for investigating mitochondrial function in O. fasciatus development:

  • Enzymatic activity assays:

    • Measure cytochrome c oxidase activity using purified recombinant COII reconstituted into liposomes

    • Compare activity parameters across developmental stages by complementing dysfunctional native enzyme with recombinant protein

    • Assess inhibitor sensitivity to identify potential differences in drug binding sites

  • Antibody generation strategy:

    • Develop stage-specific antibodies against recombinant O. fasciatus COII

    • Use for immunohistochemistry to track expression patterns during development

    • Implement for pull-down assays to identify stage-specific interaction partners

  • Structure-function correlation approach:

    • Generate site-directed mutants based on developmental stage-specific variants

    • Assess impact on enzyme kinetics and assembly into complex IV

    • Correlate findings with developmental phenotypes observed in RNAi experiments

  • Integration with developmental genetics:

    • Combine with the established RNA interference approaches demonstrated effective in O. fasciatus

    • Use recombinant COII to rescue CRISPR/Cas9-induced mutations through microinjection

    • Examine the role of COII in the context of germline development, as DNA methylation studies suggest critical roles for mitochondrial function in gametogenesis

What approaches enable investigation of post-translational modifications in recombinant Oncopeltus fasciatus COII?

Post-translational modifications (PTMs) in COII significantly impact its function and can be studied through:

  • Mass spectrometry workflow:

    • Employ bottom-up proteomics with multiple proteases (trypsin, chymotrypsin, Glu-C)

    • Implement enrichment strategies for phosphopeptides (TiO2) and glycopeptides (lectin affinity)

    • Use electron transfer dissociation (ETD) for improved PTM site localization

  • Site-directed mutagenesis approach:

    • Create an alanine substitution library at predicted PTM sites

    • Assess impact on enzyme activity, stability, and assembly

    • Compare with native COII isolated from different developmental stages

  • In vitro modification systems:

    • Reconstitute kinase reactions using recombinant COII and O. fasciatus tissue extracts

    • Implement in vitro glycosylation using microsomes from insect cells

    • Develop activity assays to correlate modifications with functional changes

  • Comparative analysis strategy:

    • Compare PTM patterns between recombinant COII produced in different expression systems

    • Assess differences between native COII isolated from O. fasciatus and recombinant protein

    • Map modifications to structural models to predict functional impact

Common PTM TypeDetection MethodFunctional ImpactPrevalence in Insect COII
PhosphorylationMS/MS, Pro-Q Diamond stainingActivity regulationModerate, typically on Ser/Thr
AcetylationMS/MS, Western blotProtein stabilityLow, N-terminal positions
GlycosylationLectin blotting, PAS stainingMembrane integrationVariable, often on Asn sites
Oxidative modificationsRedox proteomicsFunctional declineHigh, especially during stress

What are the optimal methods for using recombinant Oncopeltus fasciatus COII in evolutionary studies and phylogenetic analysis?

Recombinant COII provides unique opportunities for evolutionary studies:

  • Functional evolution assessment:

    • Express COII variants from related hemipteran species in identical systems

    • Compare enzymatic parameters (Km, Vmax, thermal stability) under standardized conditions

    • Correlate functional differences with ecological adaptations

  • Ancestral sequence reconstruction approach:

    • Use O. fasciatus COII as a reference point for hemipteran evolution

    • Reconstruct ancestral COII sequences at key evolutionary nodes

    • Express and characterize reconstructed proteins to test evolutionary hypotheses

  • Selection analysis workflow:

    • Compare recombinant COII function with selection analyses of sequence data

    • Identify sites under positive selection and test functional consequences through mutagenesis

    • Use the O. fasciatus genomic data as foundation for comparative genomics

  • Heterologous complementation strategy:

    • Express O. fasciatus COII in model systems with COII knockouts

    • Compare complementation efficiency across evolutionary distances

    • Identify critical residues for species-specific functions through chimeric constructs

The availability of the O. fasciatus genome assembly provides essential sequence data for evolutionary comparisons, while the established molecular techniques in this species, including CRISPR/Cas9 mutagenesis and RNAi , enable functional validation of evolutionary hypotheses.

How can researchers address the challenges of recombinant COII insolubility and inclusion body formation?

Membrane proteins like COII frequently form inclusion bodies during recombinant expression:

  • Refolding strategies from inclusion bodies:

    • Solubilize inclusion bodies in 8M urea or 6M guanidine hydrochloride

    • Implement stepwise dialysis with decreasing denaturant concentrations

    • Add detergents (0.1% DDM) and lipids (0.05% PC/PE) during refolding

    • Maintain reducing environment with 1-5 mM DTT or 2-10 mM β-mercaptoethanol

  • Expression optimization to enhance solubility:

    • Reduce temperature to 16-18°C during induction

    • Decrease inducer concentration (0.1 mM IPTG for bacterial systems)

    • Co-express with chaperones (GroEL/ES, DnaK/J)

    • Test fusion partners that enhance solubility (MBP, SUMO, thioredoxin)

  • Detergent screening protocol:

    • Implement systematic screening of detergent types and concentrations

    • Test mild detergents first (DDM, LMNG, CHAPS)

    • Optimize detergent:protein ratio for maximum extraction efficiency

  • Alternative expression strategies:

    • Express individual domains separately if full-length protein remains insoluble

    • Test cell-free expression systems supplemented with nanodiscs or liposomes

    • Consider synthetic peptide approaches for specific regions of interest

What quality control methods ensure the functionality of purified recombinant Oncopeltus fasciatus COII?

Ensuring functional integrity of recombinant COII requires rigorous quality control:

Quality ParameterMethodAcceptance CriteriaTroubleshooting Approach
PuritySDS-PAGE, SEC>90%Additional purification steps
Heme incorporationUV-Vis spectrumCharacteristic peaks at 420, 550, 604 nmHeme supplementation during expression
Enzymatic activityCytochrome c oxidation>50% of native enzyme activityOptimize reconstitution conditions
ThermostabilitynanoDSFTm >45°CBuffer optimization, stabilizing additives
Oligomeric stateBN-PAGEConsistent with native complexDetergent screening, crosslinking

How do researchers effectively address contamination with host cell cytochrome c oxidase when purifying recombinant Oncopeltus fasciatus COII?

Contamination with host cell cytochrome c oxidase presents a significant challenge:

  • Expression system selection strategy:

    • Consider using E. coli C41/C43 strains with reduced endogenous cytochrome expression

    • Implement CRISPR-modified insect cell lines with reduced host COII expression

    • Use P. pastoris strains with deletions in mitochondrial assembly pathways

  • Differential tagging approach:

    • Design expression constructs with multiple affinity tags (His6, FLAG, Strep-tag II)

    • Implement tandem affinity purification to eliminate host contaminants

    • Use species-specific antibodies for immunoprecipitation

  • Chromatographic separation optimization:

    • Develop ion exchange protocols exploiting pI differences between recombinant and host proteins

    • Implement hydrophobic interaction chromatography to separate based on surface hydrophobicity

    • Use hydroxyapatite chromatography effective for separating cytochrome proteins

  • Activity-based discrimination methods:

    • Utilize species-specific inhibitors to differentiate host vs. recombinant activity

    • Implement differential scanning fluorimetry to identify conditions that selectively destabilize host proteins

    • Use mass spectrometry with parallel reaction monitoring to quantify contamination levels

What are the most effective strategies for validating antibodies generated against recombinant Oncopeltus fasciatus COII?

Antibody validation is crucial for ensuring specificity and reproducibility:

  • Cross-reactivity assessment:

    • Test against recombinant COII from related hemipteran species

    • Evaluate against total O. fasciatus tissue lysates from different developmental stages

    • Screen against fractionated mitochondrial proteins

  • Knockout/knockdown validation approach:

    • Use RNAi-mediated knockdown of COII in O. fasciatus

    • Implement CRISPR/Cas9 to generate cellular models with COII mutations

    • Compare antibody reactivity between wild-type and knockdown samples

  • Epitope mapping protocol:

    • Generate peptide arrays covering the COII sequence

    • Test antibody binding to identify precise epitopes

    • Perform competition assays with free peptides to confirm specificity

  • Application-specific validation:

    • For Western blotting: Confirm single band of expected molecular weight

    • For immunohistochemistry: Verify subcellular localization to mitochondria

    • For immunoprecipitation: Confirm pull-down of known interaction partners

Validation ParameterMethodSuccess CriteriaPotential Issues
SpecificityWestern blot on tissue lysatesSingle band at expected MWCross-reactivity with related proteins
SensitivityDilution seriesDetection at 10-50 ng proteinBackground in complex samples
ReproducibilityInter-lab testingConsistent results across labsAntibody lot variation
Application versatilityMulti-technique testingFunctionality in WB, IHC, IPEpitope accessibility differences
Knockout controlsRNAi samples Reduced/absent signalIncomplete knockdown

How can recombinant Oncopeltus fasciatus COII contribute to understanding mitochondrial involvement in developmental processes?

Recombinant COII offers novel approaches to studying developmental mitochondrial biology:

  • Developmental proteomics integration:

    • Use recombinant COII as a standard for absolute quantification in developmental proteomics

    • Compare COII post-translational modification patterns across developmental stages

    • Identify stage-specific interaction partners through pull-down experiments

  • Tissue-specific mitochondrial function assessment:

    • Develop tissue-specific antibodies against recombinant COII

    • Map COII expression patterns during embryonic development

    • Correlate with mitochondrial activity measurements in different tissues

  • Gametogenesis research applications:

    • Investigate COII function in the context of gametogenesis, building on findings of mitochondrial involvement in O. fasciatus reproduction

    • Examine the relationship between COII function and DNA methylation patterns in gametes

    • Study mitochondrial inheritance patterns using tagged recombinant COII

  • Integration with developmental genetic approaches:

    • Combine with established RNAi techniques in O. fasciatus

    • Use the sequenced genome to identify regulatory elements controlling COII expression

    • Implement CRISPR/Cas9 approaches to study the impact of COII mutations on development

The studies on Dnmt1 in O. fasciatus gametogenesis suggest critical roles for mitochondrial function in reproduction, providing a foundation for investigating COII's developmental roles.

What approaches enable comparative analysis of Oncopeltus fasciatus COII with orthologs from other insect species?

Comparative analysis of COII across species reveals evolutionary patterns:

  • Heterologous expression strategy:

    • Express COII from multiple hemipteran species in identical systems

    • Standardize purification protocols to enable direct functional comparisons

    • Perform side-by-side enzymatic characterization

  • Chimeric protein approach:

    • Generate domain-swapped chimeras between O. fasciatus COII and orthologs

    • Map functional differences to specific protein regions

    • Identify species-specific adaptations in enzyme kinetics

  • Structural biology integration:

    • Compare structures of COII from multiple species

    • Map sequence divergence onto structural models

    • Identify conserved functional cores versus variable surface regions

  • Evolutionary rate analysis workflow:

    • Calculate evolutionary rates across COII sequences using the O. fasciatus genome as reference

    • Correlate rate variations with functional differences

    • Identify sites under positive or purifying selection

SpeciesSequence Identity with O. fasciatus COIIKey Functional DifferencesEcological Context
Rhodnius prolixus~75-80%Enhanced thermal stabilityHematophagous, disease vector
Halyomorpha halys~80-85%Altered substrate affinityAgricultural pest
Gerris sp.~70-75%Modified regulatory sitesSemi-aquatic adaptation
Acyrthosiphon pisum~65-70%Unique cofactor interactionsPhloem-feeding specialist

How can researchers integrate recombinant COII studies with broader -omics approaches in Oncopeltus fasciatus research?

Integrating COII research with multi-omics analyses provides comprehensive insights:

  • Proteomics integration strategy:

    • Use recombinant COII as a standard for targeted proteomics

    • Perform interactome mapping using tagged recombinant protein

    • Identify post-translational modification patterns through comparative proteomics

  • Transcriptomics correlation approach:

    • Correlate COII expression patterns with global transcriptomic changes

    • Identify co-regulated genes involved in mitochondrial function

    • Map transcriptional responses to COII dysfunction

  • Metabolomics workflow:

    • Measure metabolic changes associated with COII mutations or knockdowns

    • Monitor TCA cycle intermediates and electron transport chain activity

    • Identify metabolic adaptations to mitochondrial dysfunction

  • Multi-omics data integration:

    • Apply network analysis to integrate COII-centered multi-omics data

    • Implement machine learning approaches to identify key regulatory nodes

    • Develop predictive models of mitochondrial function based on multi-omics signatures

The availability of the O. fasciatus genome assembly provides a crucial foundation for these integrative approaches, enabling comprehensive mapping of COII function within the broader cellular context.

What methodological approaches best leverage recombinant COII to study environmental adaptation in Oncopeltus fasciatus?

Recombinant COII provides tools for investigating environmental adaptation:

  • Temperature adaptation studies:

    • Characterize thermal stability of recombinant COII under varying conditions

    • Compare enzyme kinetics across temperature ranges relevant to the species' distribution

    • Identify temperature-sensitive mutations through site-directed mutagenesis

  • Stress response analysis workflow:

    • Examine post-translational modifications induced by environmental stressors

    • Assess changes in COII interactions with other proteins under stress conditions

    • Correlate with organismal responses to environmental challenges

  • Xenobiotic interaction assessment:

    • Screen for interactions between recombinant COII and environmental toxicants

    • Identify compounds that specifically inhibit insect COII versus mammalian orthologs

    • Characterize the molecular basis of selective toxicity

  • Ecological adaptation correlation approach:

    • Compare COII variants from O. fasciatus populations in different habitats

    • Express population-specific variants as recombinant proteins

    • Correlate functional differences with ecological parameters

These approaches can leverage the established molecular techniques in O. fasciatus, including CRISPR/Cas9 mutagenesis and RNAi , to validate findings from in vitro studies with recombinant COII in the whole organism context.

What are the current limitations in recombinant Oncopeltus fasciatus COII research and how might they be addressed?

Current research faces several methodological challenges:

  • Expression system limitations:

    • Challenge: Obtaining sufficient quantities of properly folded recombinant COII

    • Solution approaches: Optimize expression conditions in insect cell systems; develop specialized membrane protein expression strains; implement cell-free expression with membrane mimetics

  • Structural characterization barriers:

    • Challenge: Obtaining high-resolution structural data for membrane-bound COII

    • Solution approaches: Implement advanced cryo-EM techniques; develop stabilized constructs through directed evolution; use computational approaches informed by the O. fasciatus genome

  • Functional assay standardization:

    • Challenge: Variability in activity measurements across laboratories

    • Solution approaches: Develop standardized protocols; create reference materials; implement round-robin testing

  • Translation to in vivo contexts:

    • Challenge: Connecting in vitro findings with organismal phenotypes

    • Solution approaches: Integrate with established RNAi techniques ; leverage CRISPR/Cas9 capabilities ; develop tissue-specific genetic tools

These limitations can be addressed through collaborative efforts that combine the molecular tools established in O. fasciatus with advanced biochemical and structural approaches developed for membrane protein research.

How might future technologies enhance research on recombinant Oncopeltus fasciatus COII?

Emerging technologies promise to transform COII research:

  • Advanced structural biology approaches:

    • Cryo-electron tomography for visualizing COII in native membrane environments

    • Microcrystal electron diffraction for structural analysis of challenging membrane proteins

    • Integrative structural biology combining multiple data types for complete models

  • Single-molecule techniques:

    • Single-molecule FRET to measure conformational changes during catalysis

    • Optical tweezers to investigate protein-protein interactions

    • High-speed AFM to visualize dynamic structural changes

  • Synthetic biology applications:

    • Cell-free expression systems optimized for membrane proteins

    • Minimal cell models to study COII function in controlled environments

    • De novo designed COII variants with enhanced properties

  • Computational method advancement:

    • AI-driven protein structure prediction tailored for membrane proteins

    • Molecular dynamics simulations at extended timescales

    • Systems biology models integrating multi-omics data

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.