MT-ND4L is a recombinant protein expressed in E. coli as a full-length 98-amino acid polypeptide (1–98 aa) fused to an N-terminal His-tag (UniProt ID: P69306) . Key specifications include:
The MT-ND4L gene resides in mitochondrial DNA and overlaps with the MT-ND4 gene in humans, sharing a 7-nucleotide sequence . This overlap ensures efficient transcription and translation.
Amino Acid Sequence:
MTPVHFSFTSAFILGLMGLAFHRTHLLSALLCLEGMMLSLFIALSLWALQMEATGYSVAP MLLLAFSACEASAGLALLVATARTHGTDRLQSLNLLQC .
Subcellular Localization: Multi-pass transmembrane protein embedded in the mitochondrial inner membrane .
MT-ND4L is a core subunit of Complex I, the largest enzyme in the electron transport chain. It participates in:
Electron Transfer: Facilitates the transfer of electrons from NADH to ubiquinone, generating a proton gradient for ATP synthesis .
Proton Pumping: Contributes to the transmembrane movement of protons, critical for ATP production .
The recombinant MT-ND4L protein is produced via bacterial expression systems (E. coli) and purified to >90% homogeneity. Key steps include:
Cloning: Insertion of the MT-ND4L gene into a bacterial expression vector.
Induction: Growth under optimized conditions to maximize protein yield.
Purification: Affinity chromatography leveraging the His-tag, followed by SDS-PAGE validation .
MT-ND4L serves as a model for studying mitochondrial disorders and Complex I dysfunction.
Leber’s Hereditary Optic Neuropathy (LHON): The T10663C mutation (Val65Ala) disrupts Complex I function, impairing ATP production and vision .
Metabolic Disorders: Variants in MT-ND4L correlate with obesity, diabetes, and hypertension .
MT-ND4L differs from other subunits in its mitochondrial origin and functional specificity:
| Subunit | Gene Source | Role in Complex I | Disease Link |
|---|---|---|---|
| ND4L | Mitochondrial | Core transmembrane domain | LHON, metabolic disorders |
| ND4 | Mitochondrial | Proton translocation | LHON, Parkinson’s disease |
| ND5 | Mitochondrial | Peripheral arm stabilization | Mitochondrial encephalopathy |
MT-ND4L is a mitochondrially encoded gene located in the mitochondrial genome. Similar to other vertebrates, the MT-ND4L gene in Oncorhynchus clarkii exists without introns in the mitochondrial DNA. The gene is typically located between tRNA genes, as seen in human MT-ND4L, which is positioned on the mitochondrial chromosome (NC_012920.1 at positions 10470-10766) . For cutthroat trout specifically, researchers should note that the mitochondrial genome organization follows the typical vertebrate pattern, with MT-ND4L positioned in proximity to MT-ND4, though exact coordinates may vary slightly between Oncorhynchus species as indicated by phylogenetic studies of this genus .
When designing primers for amplification of MT-ND4L from Oncorhynchus clarkii, researchers should consider conserved regions flanking the gene, often utilizing adjacent tRNA sequences as anchor points. PCR amplification protocols similar to those described for other mitochondrial genes in salmonids can be adapted, using consensus primers designed from aligned sequences of related Oncorhynchus species .
MT-ND4L encodes a critical subunit of NADH dehydrogenase (Complex I) in the mitochondrial respiratory chain. This protein enables NADH dehydrogenase (ubiquinone) activity and participates in electron transport from NADH to ubiquinone . As an integral component of respiratory chain Complex I, MT-ND4L contributes to proton translocation across the mitochondrial inner membrane, thereby participating in the proton motive force-driven ATP synthesis .
In functional studies, MT-ND4L operates within Complex I as part of the membrane domain, contributing to the proton-pumping mechanism. Structural analyses of mammalian Complex I have shown how this subunit integrates within the larger protein complex, positioning it to participate in the long-range energy coupling mechanism that connects electron transfer to proton translocation . When working with recombinant MT-ND4L, researchers should consider that its proper folding and integration into Complex I are essential for functional studies.
Expressing mitochondrial membrane proteins like MT-ND4L presents several challenges that researchers should address methodically:
Expression System Selection: Due to the hydrophobic nature of MT-ND4L, bacterial expression systems often result in inclusion body formation. For higher solubility and proper folding, consider:
Insect cell expression systems (Sf9, High Five)
Mammalian expression systems (HEK293, CHO cells)
Cell-free expression systems supplemented with lipids or detergents
Codon Optimization: The mitochondrial genetic code differs from the standard genetic code, so codon optimization for the expression host is essential. For Oncorhynchus clarkii MT-ND4L, adapting the sequence to E. coli, insect cells, or mammalian cells is necessary to prevent premature truncation and improve expression yields.
Fusion Tags and Solubility Enhancers: Consider fusion constructs with:
N-terminal MBP (maltose-binding protein) for solubility enhancement
C-terminal His-tag for purification (avoiding N-terminal tagging that might interfere with membrane insertion)
Thioredoxin fusion for disulfide bond formation if applicable
Expression Conditions: For bacterial systems, if attempted:
Reduce expression temperature to 18-20°C
Use lower IPTG concentrations (0.1-0.5 mM)
Consider specialized E. coli strains designed for membrane protein expression (C41(DE3), C43(DE3))
For any expression approach, verification of proper folding through activity assays is essential, as structural authenticity is critical for functional studies of MT-ND4L.
Purifying recombinant MT-ND4L requires specialized approaches due to its hydrophobic nature:
Membrane Solubilization:
Extract membranes from expression host cells through differential centrifugation
Solubilize using appropriate detergents:
Mild detergents like n-dodecyl-β-D-maltoside (DDM) at 1-2% (w/v)
Digitonin (1-2%) for better preservation of native interactions
CHAPS (0.5-1%) for improved stability
Chromatography Methods:
Immobilized Metal Affinity Chromatography (IMAC): For His-tagged constructs
Size Exclusion Chromatography: For final purification and buffer exchange
Ion Exchange Chromatography: As an intermediate step if needed
Critical Considerations:
Maintain detergent above critical micelle concentration in all buffers
Include stabilizing agents (glycerol 10-15%, reducing agents if appropriate)
Keep samples cold (4°C) throughout purification
Consider lipid supplementation to maintain protein stability
Purity Assessment:
SDS-PAGE with specialized staining for hydrophobic proteins
Western blot using antibodies against the fusion tag or MT-ND4L
Mass spectrometry for confirming protein identity
During purification, monitoring the functional integrity of MT-ND4L is challenging but can be approached through reconstitution experiments or binding assays with known interaction partners from Complex I.
Assessing functional integrity of recombinant MT-ND4L requires specialized approaches that account for its role in Complex I:
Reconstitution Studies:
Incorporate purified MT-ND4L into liposomes or nanodiscs
Complement Complex I-deficient mitochondrial preparations
Measure restored activity through:
NADH oxidation rates
Proton pumping assays
Membrane potential measurements
Spectroscopic Analyses:
Circular dichroism to assess secondary structure integrity
Fluorescence spectroscopy with environment-sensitive probes
EPR spectroscopy for interaction with electron transport chain components
Inhibitor Binding Studies:
Evaluate interaction with known Complex I inhibitors such as piericidin A. Proper binding would indicate correct folding and functional structure. Piericidin A binding assays can reveal whether the recombinant protein maintains a native-like ubiquinone binding site, as piericidin competitively inhibits at this location .
| Assessment Method | Measurement Parameter | Expected Outcome for Functional Protein | Technical Considerations |
|---|---|---|---|
| NADH oxidation | NADH consumption rate | Increased rate in reconstituted systems | Requires other Complex I components |
| Proton pumping | pH change across membrane | Acidification of liposome interior | Buffer capacity affects sensitivity |
| Membrane potential | Fluorescence of potential-sensitive dyes | Dye response indicating potential formation | Background fluorescence must be controlled |
| Inhibitor binding | Binding affinity (Kd) for piericidin A | Nanomolar affinity range | Requires specialized binding assays |
The structural differences between fish and mammalian MT-ND4L reflect evolutionary adaptations to different physiological environments:
Transmembrane Domain Organization:
Cutthroat trout MT-ND4L, like other fish homologs, contains distinct adaptations in its transmembrane helices compared to mammalian versions. Analysis of convergent/parallel amino acid substitutions in deep-sea fishes has revealed adaptive changes in MT-ND4L and other Complex I subunits . These adaptations likely influence proton pumping efficiency under different temperature and pressure conditions.
Key Functional Residues:
The ubiquinone-binding region shows both conservation and species-specific variations. In mammalian Complex I, specific residues create a hydrophobic channel for the isoprenoid tail of ubiquinone . Comparative analysis would likely reveal substitutions in Oncorhynchus clarkii that optimize function in cold-water environments.
Inter-subunit Interactions:
The positioning of MT-ND4L within Complex I creates specific interaction surfaces with neighboring subunits. In fish, these interaction sites may show adaptations that enhance complex stability under their physiological conditions. Three-dimensional representation of convergent/parallel amino acid sites in deep-sea fishes has identified specific positions in NADH-ubiquinone oxidoreductase chains that differ from shallow-water species .
When designing experiments involving Oncorhynchus clarkii MT-ND4L, researchers should consider these structural differences, particularly if integrating the protein into hybrid complexes or using mammalian-derived inhibitors or substrates.
MT-ND4L shows interesting evolutionary patterns within the Oncorhynchus genus that reflect both functional constraints and adaptation:
Phylogenetic Relationships:
Within the Oncorhynchus genus, phylogenetic analyses using mitochondrial genes (including MT-ND4L) have helped resolve relationships between species. For example, research has provided strong evidence that pink and chum salmon are sister species . When studying MT-ND4L from Oncorhynchus clarkii, it's important to consider its evolutionary relationship to other salmonids.
Selection Pressures:
Molecular evolutionary analyses of mitochondrial genes in fishes often focus on the ratio (ω) of nonsynonymous to synonymous substitution rates to identify selection pressures . MT-ND4L, as part of Complex I, shows evidence of functional constraints, with adaptive changes concentrated in specific regions of the protein.
Convergent Evolution:
Particularly interesting for MT-ND4L research is the evidence of convergent evolution in deep-sea fishes, which may have relevance for understanding functional adaptations in different Oncorhynchus species inhabiting various ecological niches . Methods for detecting convergent and parallel amino acid substitutions, such as those described in Zhang and Kumar (1997), can be applied to compare MT-ND4L across Oncorhynchus species from different habitats .
For researchers working with recombinant Oncorhynchus clarkii MT-ND4L, this evolutionary context provides important insights into which protein regions may be most tolerant to manipulation and which are likely essential for function.
Comparative analysis of MT-ND4L across Oncorhynchus species can reveal important functional and evolutionary insights:
Adaptation Signatures:
By analyzing MT-ND4L sequences from Oncorhynchus species inhabiting different environments (anadromous vs. landlocked, cold vs. warm water habitats), researchers can identify signatures of adaptation. These analyses can pinpoint specific amino acid positions that correlate with ecological variables.
Functional Conservation:
Determining which regions show high conservation across all Oncorhynchus species helps identify functionally critical domains. For MT-ND4L, these typically include residues involved in proton pumping, subunit interactions, and core structural elements.
Methodological Approach:
Sequence multiple Oncorhynchus species' MT-ND4L genes
Apply phylogenetic analysis using methods like those described for ND3 and GH2 genes
Use maximum likelihood, cladistic, and distance approaches to assess relationships
Identify sites under positive selection using CODEML program in PAML
Map evolutionary changes onto structural models of Complex I
This comparative approach is particularly valuable when designing mutations for structure-function studies of recombinant MT-ND4L, as it helps predict which changes might be tolerated and which might disrupt function.
MT-ND4L mutations have significant implications for understanding mitochondrial dysfunction across species:
Homologous Disease Mechanisms:
Mutations in human MT-ND4L are associated with mitochondrial disorders, including Leber hereditary optic neuropathy and diabetes mellitus . By studying MT-ND4L mutations in Oncorhynchus clarkii, researchers can gain insights into conserved pathogenic mechanisms that might apply across vertebrates.
Respiratory Chain Defects:
Complex I deficiency manifests similarly across vertebrates, with decreased NADH:ubiquinone oxidoreductase activity. Research on recombinant MT-ND4L can help elucidate how specific mutations affect:
Enzyme assembly
Catalytic efficiency
Proton pumping
ROS production
Tissue-Specific Effects:
In humans, MT-ND4L mutations often show tissue-specific pathology. Similar tissue-specificity might exist in fish, potentially affecting high-energy tissues like muscle and nervous system. This offers an opportunity to explore why certain tissues are more vulnerable to specific mitochondrial mutations.
Experimental Approaches:
Recombinant expression of wild-type and mutant MT-ND4L variants allows direct comparison of functional properties. Complementation studies in cells with endogenous MT-ND4L defects can assess the pathogenicity of variants identified in fish or humans.
MT-ND4L offers several advantages as a molecular marker for fisheries research and conservation:
Population Genetics Applications:
As part of the mitochondrial genome, MT-ND4L inheritance is maternal and lacks recombination, making it valuable for tracking population structure and maternal lineages. This can help identify distinct populations of Oncorhynchus clarkii for conservation management.
Species Identification:
In phylogenetic studies of Oncorhynchus, mitochondrial genes have been useful for resolving relationships between closely related species . MT-ND4L can serve as part of a genetic barcode for accurate identification of Oncorhynchus clarkii subspecies.
Methodological Considerations:
For effective use as a molecular marker, researchers should:
Design specific primers for MT-ND4L amplification from diverse samples
Develop standardized PCR protocols for consistent results
Establish reference sequences for different populations
Data Analysis Framework:
When using MT-ND4L as a marker, sequence data should be analyzed using:
Population genetics metrics (FST, nucleotide diversity)
Phylogenetic approaches (maximum likelihood, Bayesian inference)
Haplotype network analysis
Tests for selection pressures
This approach can help identify conservation units within Oncorhynchus clarkii and track genetic changes in populations over time.
Studying interactions between recombinant MT-ND4L and other Complex I subunits requires specialized approaches:
Co-expression Systems:
Design bicistronic or multicistronic vectors expressing MT-ND4L with interacting partners
Employ dual-tag systems for selective purification of complexes
Use split-reporter systems (e.g., split-GFP) to visualize interactions in living cells
In vitro Reconstitution:
Purify individual subunits separately and attempt stepwise reconstitution
Monitor complex assembly using size exclusion chromatography
Validate functionality of reconstituted subcomplexes through activity assays
Crosslinking Mass Spectrometry:
This powerful approach can map interaction surfaces between MT-ND4L and partner subunits:
Apply chemical crosslinkers to stabilize transient interactions
Digest crosslinked complexes and identify crosslinked peptides by mass spectrometry
Use the data to model interaction surfaces
Computational Docking:
Based on the known structure of mammalian Complex I , computational models of Oncorhynchus clarkii MT-ND4L interactions can be generated:
Create homology models of MT-ND4L and partner subunits
Perform protein-protein docking simulations
Validate predictions through mutagenesis of predicted interface residues
Interaction Mapping Table:
The ubiquinone-binding site shows both conservation and species-specific adaptations:
Structural Comparison:
Studies on mammalian Complex I have revealed that the ubiquinone-binding channel is formed by multiple subunits, with the ubiquinone headgroup binding near the terminal iron-sulfur cluster and the isoprenoid tail extending through a long hydrophobic channel . In Oncorhynchus clarkii, this channel likely maintains similar architecture but may show adaptations for functionality in cold-water environments.
Key Residues:
In mammalian Complex I, specific residues like NDUFS7-Phe86, NDUFS2-Phe167, and NDUFS2-Phe168 form π–π interactions and frame the isoprenoid units of ubiquinone . Comparative analysis would likely reveal how these key residues vary in Oncorhynchus clarkii.
Inhibitor Binding:
The binding of inhibitors like piericidin A provides insights into the ubiquinone binding site. In mammals, piericidin A binds competitively with ubiquinone, with its isoprenoid-like tail tracking along the ubiquinone-binding channel . Studies with recombinant Oncorhynchus clarkii MT-ND4L could explore whether the fish protein shows different affinities or binding modes for such inhibitors.
Functional Significance:
Variations in the ubiquinone-binding site may reflect adaptations to:
Different physiological temperatures
Varying oxygen availability
Different ubiquinone isoforms prevalent in fish tissues
Metabolic requirements specific to salmonid life cycles
When designing experiments involving recombinant MT-ND4L, researchers should consider these potential differences in ubiquinone binding and their implications for functional assays.
Working with recombinant mitochondrial membrane proteins presents several significant challenges:
Expression Barriers:
Genetic Code Differences: The mitochondrial genetic code differs from the standard genetic code, requiring codon optimization for expression in conventional systems.
Membrane Protein Toxicity: Overexpression of membrane proteins can be toxic to host cells, limiting yields.
Inclusion Body Formation: Hydrophobic proteins often form insoluble aggregates in bacterial systems.
Structural Integrity Issues:
Proper Folding: Ensuring correct folding without the native mitochondrial membrane environment is challenging.
Post-translational Modifications: Some modifications may be missing in recombinant systems.
Protein-Lipid Interactions: Native lipid environments are difficult to replicate in vitro.
Functional Assessment Difficulties:
Isolation From Complex: MT-ND4L functions as part of the larger Complex I, making individual assessment difficult.
Assay Development: Specialized assays are needed to test specific aspects of MT-ND4L function.
Stability Issues: Purified membrane proteins often show limited stability in solution.
Technical Solutions Table:
| Challenge | Solution Approach | Practical Implementation |
|---|---|---|
| Genetic code differences | Codon optimization | Synthesize gene with optimized codons for expression host |
| Membrane protein toxicity | Regulated expression systems | Use tightly controlled promoters (e.g., Tet-inducible) |
| Inclusion body formation | Solubility tags, specialized hosts | Fuse with MBP, SUMO; use C41/C43 E. coli strains |
| Proper folding | Chaperone co-expression | Co-express with GroEL/ES or specific membrane protein chaperones |
| Functional assessment | Reconstitution approaches | Incorporate into liposomes or nanodiscs with partner proteins |
Detection of mutations in MT-ND4L from biological samples requires specialized approaches:
Sequencing Considerations:
Depth Coverage: For detecting low-level heteroplasmy, deep sequencing (>1000-fold coverage) is essential .
Quality Control: Filtering for read quality and discarding sequence variants called with fewer than 100 reads helps reduce false positives .
Reference Selection: Using appropriate reference sequences from closely related Oncorhynchus species prevents misidentification of common variants.
Heteroplasmy Analysis:
Mitochondrial DNA mutations may exist in mixed populations (heteroplasmy) within a single organism. Methods to quantify heteroplasmy include:
Digital PCR for precise quantification
Single-cell approaches to assess cellular distribution
Sample Preparation Challenges:
DNA Quality: Mitochondrial DNA can degrade differently than nuclear DNA.
PCR Bias: Preferential amplification of specific variants can skew results.
Nuclear Pseudogenes: Nuclear copies of mitochondrial genes can contaminate results.
Validation Approaches:
Compare variants with existing mitochondria genome databases to exclude known normal variants .
Determine the haplotype of each subject using programs like Haplogrep .
Confirm key findings with orthogonal methods (e.g., targeted sequencing, RFLP analysis).
For Oncorhynchus clarkii MT-ND4L specifically, researchers should leverage the taxonomic information from phylogenetic studies of salmonids to distinguish between species-specific polymorphisms and potentially functional mutations .