Recombinant Oncorhynchus gorbuscha Calcitonin gene-related peptide type 1 receptor (calcrl)

Shipped with Ice Packs
In Stock

Description

Definition and Overview

The recombinant Oncorhynchus gorbuscha calcitonin gene-related peptide type 1 receptor (calcrl) is a laboratory-produced protein derived from the pink salmon (Salmo gorbuscha). It is a class B G protein-coupled receptor (GPCR) that interacts with receptor activity-modifying proteins (RAMPs) to form functional receptors for calcitonin gene-related peptide (CGRP) and adrenomedullin (AM) . This recombinant protein is expressed in E. coli with an N-terminal His-tag for purification and is used in biochemical and pharmacological studies to investigate receptor-ligand interactions and signal transduction mechanisms .

Receptor Formation and Ligand Specificity

The calcrl protein requires co-expression with RAMPs to form functional receptors:

  • RAMP1: Forms a CGRP receptor responsive to CGRP analogs (e.g., human CGRP) .

  • RAMP2: No response to human AM, suggesting species-specific interactions .

  • RAMP3: Forms a dual CGRP/AM receptor, indicating cross-reactivity with human AM .

Functional studies in Cos-7 cells demonstrated that the salmon calcrl-RAMP1 complex behaves similarly to mammalian CGRP receptors, validating its utility in structural and pharmacological research .

Comparative Analysis

The salmon calcrl shares 72% sequence identity with human calcrl and 85.8% identity with the flounder calcrl, reflecting conserved functional domains . Key differences include:

FeatureSalmon calcrlHuman calcrl
RAMP2 InteractionLimited/no response to AMForms AM1 receptor
Ligand ConformationType II β-turn (calcitonin)Type I β-turn (CGRP/AM)

These differences underscore the importance of species-specific receptor models in drug development .

Drug Discovery

  • CGRP Receptor Antagonists: Used to screen migraine therapies targeting CGRP pathways .

  • Structural Biology: Investigates ligand-binding mechanisms, as seen in studies using salmon calcitonin analogs .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order remarks for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is defined during production. If a specific tag type is required, please inform us, and we will prioritize its inclusion.
Synonyms
calcrl; Calcitonin gene-related peptide type 1 receptor; CGRP type 1 receptor; Calcitonin receptor-like receptor
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
18-465
Protein Length
Full Length of Mature Protein
Species
Oncorhynchus gorbuscha (Pink salmon) (Salmo gorbuscha)
Target Names
Target Protein Sequence
SPEVNETQEYVPVNVYHDTDVTRKKIVTAQFECYQKIMKDNDHNKIGPVCNRTWDGWLCW DDTEAGFTSEQYCPDYFQDFDPSELVTKICSDNGHWFLHPESNRTWTNYTRCNEHTNEGR MTAMNLFYLALIGHGLSLTSLLISLGIFFYFKSLSCQRITLHKNLFFSFVLNSVITIIWL TAVANNQELVQRNPTSCKVSQFIHLYLFGCNYFWMLCEGIYLHTLIVVAVFAEKQHLMWY YLLGWGFPLIPASIHAIARSYYYNDNCWISSNTSLLYIIHGPICAALLVNLFFLLNIVRV LITKLKVTHQAESSLYMKAVRATLILVPLLGIQYVLLPYKPEGRVSSEIYDYIMHILMHY QGLLVATIFCFFNGEVQGVLRRHWNQYRIQFGSTFAHSDAMRSASYTASSITEVQGCYSI DSHTEHLNGKGAPLDIETSILKSENPFT
Uniprot No.

Target Background

Function

This recombinant Oncorhynchus gorbuscha Calcitonin gene-related peptide type 1 receptor (calcrl) acts as a receptor for calcitonin-gene-related peptide (CGRP). Its receptor specificity can be influenced by accessory proteins. Receptor activation is mediated by G proteins, leading to the stimulation of adenylyl cyclase.

Protein Families
G-protein coupled receptor 2 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

Basic Research Questions

  • What are the Primary Functions of Calcitonin Gene-Related Peptide Type 1 Receptor in Salmon?

    The Calcitonin gene-related peptide type 1 receptor (calcrl) in salmon serves several important physiological functions:

    • Regulation of calcium ion homeostasis within cells

    • Mediation of signaling pathways in gill physiology and function

    • Participation in autocrine or paracrine signaling processes

    • Signal transduction via G-protein coupled mechanisms

    Studies have demonstrated that salmon gills not only possess specific receptors for calcitonin but also express the calcitonin gene itself, suggesting a localized signaling system . This contributes to the physiological regulation of salmon gills, potentially affecting ion transport, cellular function, and adaptation to different aquatic environments .

  • How Does the Expression of calcrl Vary Across Tissues in Oncorhynchus gorbuscha?

    The expression pattern of calcrl across different tissues in pink salmon (Oncorhynchus gorbuscha) shows distinct tissue specificity:

    Tissue TypeExpression LevelDetection MethodFunctional Implication
    GillsHighRT-PCR, RIAOsmoregulation, calcium homeostasis
    BrainModerate to HighRT-PCRNeuropeptide signaling
    Ultimobranchial BodyPresentRT-PCREndocrine regulation

    The high expression of calcrl in salmon gills, coupled with the presence of calcitonin gene expression in the same tissue, strongly suggests a localized autocrine or paracrine signaling system . Expression in the brain indicates potential roles in neuropeptide signaling pathways . The ultimobranchial body, which is a major site of calcitonin production in fish, also expresses calcrl, suggesting potential feedback regulation mechanisms .

  • What is the Relationship Between Calcitonin and Calcitonin Gene-Related Peptide in Salmon?

    In Oncorhynchus gorbuscha (pink salmon), calcitonin and calcitonin gene-related peptide (CGRP) exhibit a complex relationship:

    • Both peptides are derived from the same gene through alternative splicing

    • Multiple calcitonin isoforms (I, II, and the newly identified IV) exist in salmon

    • The calcitonin gene in salmon is a complex transcription unit containing exons that encode both calcitonin and CGRP molecules

    • The salmon CGRP peptide is highly homologous to CGRP molecules in other species, indicating strong evolutionary conservation

    The presence of multiple calcitonin genes and their encoded peptides suggests specialized physiological roles in salmon, potentially related to adaptation to different aquatic environments and calcium regulation needs . The high conservation of CGRP across species highlights its fundamental importance in vertebrate physiology .

Advanced Research Questions

  • What are the Optimal Experimental Conditions for Studying calcrl Receptor Signaling in vitro?

    Effectively studying calcrl receptor signaling in vitro requires careful consideration of experimental conditions:

    1. Cell System Selection:

      • Heterologous expression in HEK293 or CHO cells for controlled receptor density

      • Primary gill epithelial cells for more physiologically relevant conditions

      • Consideration of fish vs. mammalian cell backgrounds for species-specific effects

    2. Receptor Activation Protocols:

      • Stimulation with purified salmon calcitonin or CGRP at 1 nM to 1 μM concentrations

      • Temperature maintenance at 10-15°C to mimic physiological conditions for salmon proteins

      • Time-course studies (5 minutes to 24 hours) to capture both immediate and delayed signaling events

    3. Signaling Pathway Analysis:

      • cAMP measurements using ELISA or FRET-based sensors (primary pathway)

      • Calcium flux measurement with fluorescent indicators (Fluo-4, Fura-2)

      • ERK1/2 phosphorylation via Western blotting for MAPK pathway activation

      • β-arrestin recruitment assays for receptor desensitization studies

    4. Controls and Validation Approaches:

      • Non-transfected cells as negative controls

      • Dose-response curves to establish EC50 values

      • Antagonist studies to confirm receptor specificity

      • Receptor expression verification via Western blotting or immunofluorescence

    This systematic approach enables comprehensive characterization of salmon calcrl signaling mechanisms while accounting for the unique properties of this receptor system in the context of fish physiology .

  • How Can Molecular Modeling be Used to Predict Ligand Binding Sites on Oncorhynchus gorbuscha calcrl?

    Molecular modeling provides valuable insights into ligand binding sites on salmon calcrl through a multi-step approach:

    1. Homology Model Construction:

      • Use of human CALCRL crystal structures as templates (expected sequence identity: 60-70%)

      • Generation of multiple models with various software platforms (MODELLER, SWISS-MODEL)

      • Refinement focusing on transmembrane domain orientation

      • Quality assessment using Ramachandran plots, DOPE scores, and ProSA z-scores

    2. Binding Site Prediction Methods:

      • Sequence conservation analysis across species to identify functional motifs

      • Cavity detection using algorithms such as POCASA, SiteMap, or fpocket

      • Molecular dynamics simulations to identify transient binding pockets

      • Electrostatic potential mapping to locate favorable binding regions

    3. Ligand Docking and Interaction Analysis:

      Interaction TypeAnalysis MethodExpected Pattern
      Hydrogen bondsDistance and angle measurementsKey H-bonds between receptor and ligand
      Hydrophobic contactsContact surface area calculationExtensive contacts in transmembrane regions
      π-stackingAromatic interaction detectionInteractions with conserved aromatics
      Salt bridgesElectrostatic interaction mappingCritical for charged ligand portions
    4. Model Validation Strategies:

      • In silico mutagenesis of predicted key residues

      • Molecular dynamics simulations (100-500 ns) to assess complex stability

      • Comparison with experimental binding data when available

      • Cross-validation with multiple known ligands

    This systematic molecular modeling approach generates testable hypotheses about ligand binding modes that can guide experimental design and potentially facilitate development of selective modulators of salmon calcrl function .

  • What are the Key Challenges in Purifying Functional Recombinant Oncorhynchus gorbuscha calcrl Protein?

    Purifying functional calcrl presents several significant challenges that require specialized methodological approaches:

    1. Membrane Protein Solubilization:

      • Challenge: As a seven-transmembrane GPCR, calcrl is highly hydrophobic and difficult to extract while maintaining native conformation

      • Solution: Systematic screening of detergents, beginning with mild non-ionic detergents such as DDM (n-Dodecyl β-D-maltoside, 1-2%) or LMNG (0.01-0.1%)

      • Methodology: Two-phase extraction with initial solubilization at 4°C for 2-4 hours, followed by high-speed centrifugation

    2. Maintaining Functional Conformation:

      • Challenge: The complex tertiary structure is easily disrupted during purification

      • Solution: Addition of stabilizing agents including cholesterol hemisuccinate (0.1-0.2%), specific lipids, and ligands at sub-saturating concentrations

    3. Expression Systems and Yields:

      • Challenge: E. coli expression often results in misfolded protein in inclusion bodies

      • Solution: Consider alternative expression systems such as insect cells (Sf9, Hi5) or mammalian expression systems for complex post-translational modifications

    4. Purification Strategy:

      • Challenge: Multi-step purification can lead to activity loss

      • Solution: Streamlined protocol using His-tag affinity chromatography followed by size exclusion chromatography

    5. Functional Validation:

      • Challenge: Confirming that purified receptor retains ligand-binding properties

      • Solution: Implement binding assays such as microscale thermophoresis or reconstitution into proteoliposomes for functional assays

    By addressing these challenges methodically, researchers can improve the yield and quality of purified salmon calcrl for structural studies and functional characterization .

  • How Can Evolutionary Analysis of calcrl Across Fish Species Inform Our Understanding of Its Functional Evolution?

    Evolutionary analysis of calcrl across fish species provides crucial insights into its functional evolution and adaptation:

    1. Phylogenetic Analysis Framework:

      • Sequence acquisition from diverse fish lineages (jawless fish, cartilaginous fish, ray-finned fish, lobe-finned fish)

      • Multiple sequence alignment using specialized GPCR-focused parameters

      • Tree construction using Maximum Likelihood and Bayesian inference methods

    2. Molecular Evolution Analyses:

      • Selection analysis using dN/dS ratios to identify positively/negatively selected sites

      • Functional divergence assessment to detect shifts in evolutionary rates

      • Ancestral sequence reconstruction to track sequence changes across evolutionary time

      • Coevolution analysis to identify networks of co-evolving residues

    3. Structural Evolution Assessment:

      • Homology modeling across representative species

      • Mapping of conserved vs. variable regions onto 3D structures

      • Analysis of binding pocket evolution across lineages

    4. Correlation with Environmental Adaptation:

      • Statistical association of sequence features with habitat type (marine, freshwater, euryhaline)

      • Analysis of adaptation patterns in migratory species like salmon

    5. Experimental Validation:

      • Heterologous expression of ancestral and extant calcrl variants

      • Comparative functional assays across orthologues

      • Site-directed mutagenesis to test the impact of key substitutions

    This comprehensive approach reveals how calcrl has adapted across fish species, potentially unveiling molecular mechanisms underlying habitat adaptation and physiological specialization .

  • What Role Does calcrl Play in Calcium Homeostasis in Salmon, and How Can This Be Experimentally Validated?

    Calcrl plays a significant role in salmon calcium homeostasis through several mechanisms that can be experimentally validated:

    1. Proposed Mechanisms:

      • Regulation of calcium transport across gill epithelium

      • Modulation of calcium-sensing mechanisms in specialized cells

      • Influence on hormonal pathways involving calcitonin and CGRP

    2. Experimental Validation Approaches:

      a) In vivo Studies:

      • Radioisotope (45Ca2+) uptake assays in gill tissue

      • Plasma calcium measurements after administration of calcrl agonists/antagonists

      • Knockdown studies using targeted approaches

      b) Ex vivo Tissue Studies:

      • Isolated perfused gill preparations to measure transcellular calcium transport

      • Ussing chamber techniques to quantify ion movement across gill epithelium

      c) Cellular/Molecular Approaches:

      Experimental ApproachKey ParametersExpected OutcomesControls
      Radioisotope flux45Ca2+ (0.5-1 μCi/ml), 1-4 hours exposureAltered calcium uptake ratesHeat-inactivated tissues
      Plasma calcium analysisSampling at 0, 1, 3, 6, 24 hours, Dose: 0.1-10 μg/kgTemporal changes in calcium levelsVehicle control
      Gill perfusionFlow rate: 1-2 ml/min, Temperature: 10-12°CChanges in calcium fluxPaired control tissues
      Gene expressionqPCR for calcium transportersAltered expression patternsHousekeeping gene normalization
    3. Physiological Relevance Assessment:

      • Compare responses in freshwater vs. seawater adapted salmon

      • Assess seasonal variations in receptor function

      • Investigate developmental changes during different life stages

    These methodological approaches provide a comprehensive framework for validating the specific roles of calcrl in salmon calcium homeostasis, potentially revealing novel regulatory mechanisms .

  • What are the Experimental Approaches to Evaluate the Potential Role of calcrl in Salmon Osmotic Regulation?

    The potential role of calcrl in salmon osmotic regulation can be systematically evaluated through:

    1. Whole-Organism Approaches:

      • Salinity challenge tests with transfers between freshwater and seawater

      • Measurement of calcrl expression changes at defined intervals post-transfer

      • Correlation with physiological indicators of osmotic stress

      • Pharmacological intervention with calcrl agonists/antagonists

    2. Tissue-Level Investigations:

      • Gill perfusion studies with controlled media composition

      • Manipulation of calcrl signaling while measuring ion flux

      • Immunohistochemical co-localization of calcrl with osmoregulatory proteins

      ParameterFreshwater ConditionsSeawater Conditions
      External Na+0.5-1 mM450-500 mM
      External Cl-0.5-1 mM450-500 mM
      External Ca2+0.2-0.5 mM10-11 mM
      pH7.4-7.88.0-8.2
      Temperature10-12°C10-12°C
    3. Cellular Mechanistic Studies:

      • Primary gill cell cultures from chloride cells and pavement cells

      • Measurement of ion transport processes after calcrl stimulation

      • Patch-clamp recordings of ion channel activity

      • Transepithelial potential measurements in gill cell monolayers

    4. Molecular and Biochemical Analyses:

      • Determination of second messenger systems activated (cAMP, calcium)

      • Identification of downstream phosphorylation targets

      • RNA-seq analysis of gill tissue after calcrl modulation

      • Validation of key targets by qPCR

    5. Genetic Approaches:

      • CRISPR-Cas9 mediated calcrl modification

      • Assessment of osmoregulatory capacity under different salinity challenges

      • Rescue experiments with wild-type calcrl

    This multi-level approach provides a comprehensive framework for evaluating calcrl's role in salmon osmotic regulation, potentially revealing novel mechanisms applicable to aquaculture and conservation efforts .

  • How Can Recombinant Oncorhynchus gorbuscha calcrl Be Used to Study CGRP Signaling Pathways?

    Recombinant Oncorhynchus gorbuscha calcrl provides a valuable tool for studying CGRP signaling pathways through several methodological approaches:

    1. Receptor-Ligand Interaction Studies:

      • Binding assays using labeled CGRP (either radiolabeled or fluorescently tagged)

      • Competition studies to determine binding affinities of different CGRP isoforms

      • Investigation of receptor activation kinetics and desensitization patterns

      • Analysis of receptor internalization following CGRP binding

    2. Signaling Cascade Characterization:

      • Measurement of second messenger production (primarily cAMP via Gs-protein coupling)

      • Real-time calcium monitoring using fluorescent indicators

      • Phosphorylation studies of downstream effectors (MAPK, PKA substrates)

      • Transcriptional regulation analysis using reporter gene assays

    3. Comparative Studies:

      • Parallel analysis of salmon calcrl with mammalian CALCRL responses

      • Investigation of species-specific differences in signaling dynamics

      • Identification of conserved vs. divergent signaling mechanisms

      • Heterologous expression in various cell backgrounds to assess cellular context effects

    4. Pharmacological Profiling:

      • Screening of CGRP antagonists for effects on salmon calcrl

      • Structure-activity relationship studies with modified CGRP peptides

      • Investigation of receptor modulation by allosteric compounds

      • Cross-reactivity analysis with related peptides (adrenomedullin, amylin)

    5. Physiological Context Reconstruction:

      • Co-expression with accessory proteins (RAMPs) that may modify receptor function

      • Creation of artificial cell systems that mimic gill epithelial conditions

      • Temperature-dependent studies to reflect salmon physiological conditions

    Through these approaches, researchers can gain valuable insights into evolutionary conservation and divergence of CGRP signaling mechanisms, potentially identifying novel regulatory pathways with relevance to both fish physiology and broader vertebrate biology .

  • What Insights Can Be Gained From Studying the Relationship Between CALCRL and Acute Myeloid Leukemia?

    Studying CALCRL in the context of Acute Myeloid Leukemia (AML) provides several important insights:

    1. Prognostic Value:

      • CALCRL expression levels are significantly higher in AML patients with the AML/ETO fusion gene compared to patients with non-malignant hematological diseases

      • CALCRL expression correlates with clinical outcomes and could serve as a prognostic factor for designing chemotherapy regimens and evaluating transplantation risk

    2. Disease Mechanisms:

      • CALCRL contributes to drug resistance in AML by controlling the ADM-CALCRL axis

      • The gene plays important roles in stemness and chemotherapy resistance in AML

      • Knockdown of CALCRL in leukemic stem cell subpopulations decreases stem cell frequency and sensitizes cells to chemotherapeutic agents

    3. Therapeutic Implications:

      • CALCRL may represent a potential therapeutic target in AML treatment

      • Antibodies interfering with CALCRL signaling (already approved for migraine treatment) might be repurposed as add-on therapies for AML

      • Targeting CALCRL could help eradicate relapse-initiated cells in AML

    4. Experimental Approaches:

      • Analysis of CALCRL expression in patient samples using qRT-PCR

      • Correlation of expression levels with clinical features and outcomes

      • Functional studies exploring the mechanisms by which CALCRL contributes to leukemogenesis and therapy resistance

      • Preclinical testing of CALCRL-targeting approaches in AML models

    These findings suggest that understanding CALCRL signaling in different contexts, including comparative studies with salmon calcrl, may provide novel insights into both evolutionary biology and potential therapeutic approaches for human diseases .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.