Recombinant Oncorhynchus gorbuscha NADH-ubiquinone oxidoreductase chain 3 (MT-ND3)
Description
Molecular Characterization
Protein Structure:
-
Amino Acid Sequence:
MNLITTIITITITLSAVLATISFWLPQISPDAEKLSPYECGFDPLGSARLPFSLRFFLIA ILFLLFDLEIALLLPLPWGDQLNTPTLTLIWSTAVLALLTLGLIYEWTQGGLEWAE.
Expression System:
Produced in Escherichia coli (E. coli), ensuring high yield and scalability .
Functional Role in Mitochondrial Complex I
MT-ND3 is a core subunit of NADH-ubiquinone oxidoreductase (Complex I), essential for:
-
Electron Transport: Catalyzes electron transfer from NADH to ubiquinone in the respiratory chain .
-
Pathological Relevance: Mutations in MT-ND3 are linked to mitochondrial disorders such as Leigh syndrome and Parkinson’s disease .
Research Applications
-
Enzyme Activity Assays: Used to study Complex I dysfunction in mitochondrial diseases .
-
Structural Studies: Facilitates crystallography and cryo-EM analyses due to high purity .
-
ELISA Development: Available for immunological assays (e.g., antibody validation) .
Quality Control and Stability
Product Specs
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will fulfill your request if possible.
Note: All our proteins are shipped with standard blue ice packs by default. If dry ice shipping is required, please inform us in advance. Additional fees will apply.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
