Recombinant Oncorhynchus gorbuscha NADH-ubiquinone oxidoreductase chain 4L (MT-ND4L)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery time information.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life depends on various factors such as storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
MT-ND4L; MTND4L; NADH4L; ND4L; NADH-ubiquinone oxidoreductase chain 4L; NADH dehydrogenase subunit 4L
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-98
Protein Length
full length protein
Species
Oncorhynchus gorbuscha (Pink salmon) (Salmo gorbuscha)
Target Names
Target Protein Sequence
MTPVHFSFTSAFILGLMGLAFHRTHLLSALLCLEGMMLSLFIALSLWALQMEATGYSVAP MLLLAFSACEASAGLALLVATARTHGTDRLQSLNLLQC
Uniprot No.

Target Background

Function
This protein is a core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I). It is believed to be part of the minimal assembly necessary for catalysis. Complex I functions in transferring electrons from NADH to the respiratory chain. Ubiquinone is thought to be the immediate electron acceptor for the enzyme.
Protein Families
Complex I subunit 4L family
Subcellular Location
Mitochondrion membrane; Multi-pass membrane protein.

Q&A

What is the functional role of MT-ND4L in mitochondrial energy production?

MT-ND4L (NADH dehydrogenase 4L) functions as an essential component of Complex I (NADH:ubiquinone oxidoreductase) in the mitochondrial respiratory chain. This protein participates in the first step of the electron transport process, specifically in transferring electrons from NADH to ubiquinone during oxidative phosphorylation. As part of Complex I, MT-ND4L contributes to creating an unequal electrical charge across the inner mitochondrial membrane through electron transfer, which ultimately provides the energy necessary for ATP production .

The protein is embedded within the inner mitochondrial membrane as part of the membrane domain of Complex I. While small in size compared to other components of the complex, MT-ND4L plays a crucial role in maintaining the structural integrity and functional capability of the entire Complex I assembly, which is central to cellular energy metabolism .

How is the structure of MT-ND4L related to its function in Complex I?

MT-ND4L adopts a primarily α-helical structure within the membrane domain of Complex I. Based on structural models, including those from AlphaFold computational predictions, the protein demonstrates high confidence scores (pLDDT global score of 89.71), indicating a relatively stable conformation despite its small size . The protein contains transmembrane helices that anchor it within the inner mitochondrial membrane.

Functionally, MT-ND4L is positioned at a critical junction within Complex I, where it contributes to the long-range energy coupling mechanism that connects electron transfer to proton translocation. The protein forms part of a chain of charged residues that extends into the membrane plane and may involve loops from membrane-bound subunits that move during catalysis . This positioning suggests MT-ND4L may participate in conformational changes necessary for the proton pumping activity of Complex I during energy transduction.

What are the optimal expression systems and purification strategies for recombinant MT-ND4L?

Expression of recombinant MT-ND4L presents significant challenges due to its hydrophobic nature and mitochondrial origin. Based on available research protocols, the following methodological approach has proven effective:

Expression Systems:

  • E. coli expression: The most commonly used system employs E. coli with specialized vectors containing N-terminal fusion tags (such as His6-ABP tag) to improve solubility and facilitate purification .

  • Codon optimization: Given the differences between mitochondrial and bacterial codon usage, codon optimization of the MT-ND4L sequence for E. coli expression is critical for obtaining adequate protein yields.

Purification Protocol:

  • Affinity chromatography using the N-terminal His6 tag

  • Size exclusion chromatography to separate monomeric protein from aggregates

  • Validation of protein quality through SDS-PAGE and Western blotting

Reconstitution Considerations:
For functional studies, purified MT-ND4L is typically reconstituted into proteoliposomes with defined phospholipid composition to mimic the native mitochondrial membrane environment . This approach allows for assessment of protein activity within a membrane context.

How can researchers reliably measure the functional activity of MT-ND4L in experimental settings?

Investigating MT-ND4L function experimentally requires several specialized approaches:

Proteoliposome-Based Activity Assays:

  • Reconstitution of purified MT-ND4L with other Complex I subunits in proteoliposomes containing appropriate phospholipids

  • Measurement of NADH oxidation rates as a function of ubiquinone concentration

  • Inclusion of AOX (alternative oxidase) to recycle ubiquinol back to ubiquinone in continuous assays

Inhibitor Studies:
Competitive inhibition assays using Complex I inhibitors like piericidin A provide valuable insights into MT-ND4L function. By titrating NADH oxidation rates with increasing inhibitor concentrations at varying ubiquinone concentrations, researchers can generate Michaelis-Menten curves to determine apparent Km and Vmax values . These values typically demonstrate non-competitive inhibition patterns with both parameters decreasing with increasing inhibitor concentration.

Data Analysis Framework:

Ubiquinone Concentration (μM)NADH Oxidation Rate (no inhibitor)NADH Oxidation Rate (with piericidin A)Inhibition Pattern
5LowVery lowNon-competitive
10ModerateLowNon-competitive
20HighModerateNon-competitive
50MaximumModerateNon-competitive

This inhibition pattern suggests complex interactions between MT-ND4L, ubiquinone, and inhibitors, which provides insights into the protein's role in electron transport .

How conserved is MT-ND4L across different vertebrate species, and what does this reveal about its evolutionary importance?

MT-ND4L demonstrates significant sequence conservation across vertebrate species, reflecting its fundamental role in mitochondrial energy production. Comparative analysis between Oncorhynchus gorbuscha (pink salmon) MT-ND4L and its orthologs in other species reveals:

Conservation Analysis:

  • High sequence conservation in the transmembrane domains

  • Greater variability in loop regions

  • Preservation of key functional residues involved in ubiquinone interaction

Phylogenetic analyses based on complete mitochondrial genomes, including MT-ND4L, have been used to establish evolutionary relationships between species. For example, in studies of cichlid fish, MT-ND4L sequences were examined alongside other mitochondrial genes using maximum likelihood methods under the generalized time reversible model .

Evolutionary Implications:
The conservation of MT-ND4L structure and function across diverse vertebrate lineages, from fish like Oncorhynchus gorbuscha to mammals, underscores its critical importance in cellular metabolism. This conservation makes it a valuable target for studying fundamental aspects of mitochondrial function across species.

What specialized techniques allow for accurate phylogenetic analysis using MT-ND4L sequences?

Researchers employ several sophisticated approaches when using MT-ND4L for phylogenetic studies:

Sequence Alignment Methods:

  • Multiple sequence alignment using MUSCLE or MAFFT algorithms

  • Manual curation to address insertions/deletions in highly variable regions

  • Codon-based alignments to maintain reading frame integrity

Phylogenetic Reconstruction:

  • Maximum likelihood analysis using FastTree V2 under the generalized time reversible (GTR) model

  • Bayesian inference methods for complex evolutionary models

  • Use of appropriate outgroups (e.g., Oncorhynchus keta has been used as an outgroup in some studies)

Nucleotide Composition Analysis:
Examining AT and GC skew patterns in MT-ND4L compared to other mitochondrial genes provides insights into evolutionary pressures. For example, studies show that GC skews of MT-ND4L are typically negative, except in certain species where they may be positive or symmetric .

What techniques enable researchers to investigate the electron transport mechanism involving MT-ND4L?

Understanding the electron transport mechanism requires sophisticated experimental approaches:

Spectroscopic Methods:

  • Electron paramagnetic resonance (EPR) spectroscopy to track electron transfer through iron-sulfur clusters

  • Fluorescence resonance energy transfer (FRET) to monitor conformational changes during catalysis

  • Time-resolved spectroscopy to measure electron transfer kinetics

Site-Directed Mutagenesis:
Systematic mutation of key residues in MT-ND4L can reveal their roles in electron transport. By measuring changes in activity following specific mutations, researchers can map functional domains involved in:

  • Electron tunneling pathways

  • Ubiquinone binding

  • Proton translocation coupling

Inhibitor-Based Mechanistic Studies:
Complex I inhibitors like piericidin A serve as valuable tools for understanding MT-ND4L function. These inhibitors compete with ubiquinone for binding sites in the enzyme complex . Studies have shown that inhibition patterns can provide insights into:

  • The geometry of the active site

  • The step-by-step mechanism of electron transfer

  • The coupling between electron transfer and proton pumping

How do inhibitors like piericidin A interact with Complex I, and what insights does this provide into MT-ND4L function?

Inhibitor studies reveal critical aspects of MT-ND4L function within Complex I:

Binding Mode Analysis:
Cryo-EM structures of mammalian Complex I with bound piericidin A show that this inhibitor binds at the top of the ubiquinone-binding channel . The piericidin molecule:

  • Has a headgroup resembling ubiquinone but with a 4-pyridone nitrogen replacing one carbonyl

  • Contains an isoprenoid tail that tracks along the ubiquinone-binding channel

  • Is surrounded by hydrophobic sidechains forming specific interactions (e.g., π–π interactions with NDUFS7 Phe86)

Functional Insights:
The interaction between piericidin and Complex I reveals:

  • The piericidin-bound complex maintains an "active" conformation, suggesting inhibition occurs by competitive site occupation rather than conformational changes

  • The hydrophobic channel that accommodates the inhibitor's tail likely serves as the binding site for ubiquinone's isoprenoid tail

  • Evidence suggests two inhibitor molecules may bind end-to-end in the substrate binding channel, indicating a potential secondary binding site

Inhibition Kinetics:
Studies in proteoliposomes reveal that piericidin affects both apparent Km and Vmax values for ubiquinone, contrary to typical competitive inhibition patterns . This suggests complex allosteric effects that may involve MT-ND4L and its interaction with other Complex I subunits.

What MT-ND4L mutations are associated with human diseases, and how do they disrupt mitochondrial function?

Mutations in MT-ND4L have significant clinical implications:

Leber Hereditary Optic Neuropathy (LHON):
The T10663C (Val65Ala) mutation in MT-ND4L has been identified in several families with LHON . This mutation substitutes valine with alanine at position 65, potentially affecting protein structure and function.

Pathogenic Mechanisms:
While the exact mechanisms remain under investigation, MT-ND4L mutations likely disrupt mitochondrial function through:

  • Altered electron transfer efficiency

  • Increased reactive oxygen species production

  • Compromised energy production in tissues with high metabolic demands, particularly retinal ganglion cells

Biochemical Consequences:
MT-ND4L mutations may affect:

  • Complex I assembly and stability

  • The ubiquinone binding site architecture

  • Coupling between electron transfer and proton pumping

What experimental models best capture the effects of MT-ND4L mutations in research settings?

Researchers employ several models to study MT-ND4L mutations:

Cellular Models:

  • Cybrid cell lines combining patient-derived mitochondria with standard nuclear backgrounds

  • CRISPR-engineered cell lines with specific MT-ND4L mutations

  • Primary cells from patients harboring MT-ND4L mutations

Functional Assays for Mutation Analysis:

  • Oxygen consumption rate measurements using Seahorse analyzers

  • ATP production assays to quantify energy deficiencies

  • Reactive oxygen species detection using fluorescent probes

  • Complex I enzymatic activity measurements in isolated mitochondria

Validation Approaches:
Complementation studies, where wild-type MT-ND4L is expressed in cells harboring mutations, can confirm the causal relationship between the mutation and observed functional defects.

What are the current challenges in understanding the energy coupling mechanism of MT-ND4L within Complex I?

Despite significant advances, several challenges remain in understanding MT-ND4L's role in energy coupling:

Structural Complexity:
The large, heterogeneous, and conformationally-labile nature of the ubiquinone binding site makes it difficult to precisely define MT-ND4L's interactions within Complex I . This complexity also explains why diverse compounds with little resemblance to ubiquinone can inhibit Complex I.

Long-Range Energy Coupling:
How electron transfer at the MT-ND4L-containing site couples to proton pumping across the membrane remains poorly understood. MT-ND4L sits at a critical junction:

  • Near the start of a chain of charged residues leading into the membrane plane

  • Involving mobile loops from membrane-bound subunits that may move during catalysis

Methodological Limitations:
Studying MT-ND4L function is technically challenging due to:

  • Difficulties in expressing and purifying active protein

  • The need to reconstitute the protein in appropriate membrane environments

  • The complexity of measuring specific contributions within the larger Complex I assembly

How might advances in structural biology techniques enhance our understanding of MT-ND4L?

Recent technological developments offer new opportunities:

Cryo-Electron Microscopy Advances:
High-resolution cryo-EM has revolutionized Complex I research, revealing:

  • The 3.0-Å resolution structure of complex I with bound inhibitors

  • Detailed visualization of the ubiquinone-binding channel

  • Conformational states corresponding to different functional states

Computational Approaches:

  • Molecular dynamics simulations to model MT-ND4L movements during catalysis

  • Quantum mechanical calculations to understand electron transfer energetics

  • AlphaFold and similar AI-based structure prediction methods providing insights into MT-ND4L structure

Time-Resolved Structural Methods: Emerging techniques like time-resolved cryo-EM and X-ray free-electron laser (XFEL) crystallography may capture transient conformational states during MT-ND4L function, providing unprecedented insights into the dynamics of energy coupling mechanisms.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.