Recombinant Oncorhynchus keta NADH-ubiquinone oxidoreductase chain 3 (MT-ND3)

Shipped with Ice Packs
In Stock

Description

Biological Function and Role in Energy Metabolism

MT-ND3 functions as an integral component of respiratory Complex I (NADH:ubiquinone oxidoreductase), one of the largest membrane-bound enzymes found in mitochondria. This complex catalyzes the first step of the electron transport chain, transferring electrons from NADH to ubiquinone (coenzyme Q10) . This process is fundamental to cellular respiration and ATP production in all eukaryotic organisms.

The energy released during this electron transfer is harnessed to pump protons across the inner mitochondrial membrane, generating an electrochemical gradient that drives ATP synthesis. In complex I, the binding site for the redox-active quinone headgroup is positioned approximately 20 Å above the membrane surface, and ubiquinone-10, despite being extremely hydrophobic, accesses this site through a specialized narrow channel .

Research indicates that this channel is long enough to accommodate almost all of ubiquinone-10's ~50-Å isoprenoid chain, highlighting the sophisticated molecular architecture of the complex in which MT-ND3 participates . The structural arrangements allow for efficient electron transfer while maintaining the integrity of the proton gradient essential for energy production.

Evolutionary Significance and Selection Patterns

One of the most fascinating aspects of MT-ND3 research concerns its evolutionary significance, particularly in salmon species. Studies examining the mitochondrial genome of Atlantic salmon have revealed compelling evidence of positive selection acting on several mitochondrial genes, including ND3 . This selective pressure indicates the functional importance of these genes in adaptation to different environmental conditions.

Specifically, research has identified a nucleotide change at position 10963:C/A in the ND3 gene that shows signs of positive selection as detected by multiple analytical methods, including FUBAR and TreeSAAP analyses . The table below summarizes some of the selection patterns observed in mitochondrial genes including ND3:

LocusPositionType of selectionMEME ω+MEME PFUBAR dN-dSFUBAR Post. PTreeSAAP (Category)
ND310963:C/A+>1000.1753.7930.918Alpha-helical tendencies (6)

The geographical distribution of mutations in the ND3 gene is not random, with some mutations being private to arctic populations of salmon . This non-random distribution suggests that selection acting on the salmon mitochondrial genome might be related to adaptations for increased metabolic efficiency at low temperatures, which would be particularly advantageous for species like chum salmon that navigate both cold ocean waters and freshwater environments during their life cycle .

Research Applications and Experimental Utility

Recombinant Oncorhynchus keta NADH-ubiquinone oxidoreductase chain 3 serves numerous research purposes in biochemistry, molecular biology, and evolutionary studies. The availability of purified recombinant forms of this protein enables researchers to investigate its structural properties, functional characteristics, and interactions with other components of the respiratory chain.

When working with recombinant proteins like MT-ND3, researchers typically follow specific protocols for reconstitution and storage to maintain protein integrity. For similar recombinant proteins, recommendations often include:

  1. Centrifuging the vial briefly before opening to bring contents to the bottom

  2. Reconstituting the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  3. Adding glycerol (typically 5-50% final concentration) for long-term storage

  4. Storing aliquots at -20°C/-80°C to avoid repeated freeze-thaw cycles

These handling procedures help ensure experimental reproducibility and maintain the structural and functional integrity of the protein during research applications.

Complex I Kinetics and Ubiquinone Binding

Studies on respiratory Complex I, of which MT-ND3 is a component, have revealed important insights into the kinetics of ubiquinone binding and electron transfer. Research using proteoliposomes containing Complex I, together with quinol oxidase, has determined the kinetics of Complex I catalysis with ubiquinones of varying isoprenoid chain length .

The hydrophobic channel through which ubiquinone accesses its binding site is interrupted by a highly charged region at isoprenoids 4-7, which likely influences the binding kinetics . Investigations have demonstrated that ubiquinol-10 dissociation is not rate-determining in the catalytic cycle and that ubiquinone-10 exhibits both the highest binding affinity and the fastest binding rate .

These findings suggest that the charged region and chain directionality within the protein complex assist product dissociation, while isoprenoid stepping ensures short transit times . These properties are particularly important for the function of Complex I under physiological conditions, though they may not benefit the exchange of short-chain quinones, for which product dissociation may become rate-limiting .

Comparative Analysis with Other Species

While much of our understanding of MT-ND3 comes from studies across various species, the specific characteristics of Oncorhynchus keta MT-ND3 can be better understood through comparative analysis. Similar recombinant proteins, such as the MT-ND3 from Baiomys taylori, provide valuable comparative data .

For research purposes, recombinant proteins are often tagged with additional sequences to facilitate purification and detection. For example, the Baiomys taylori MT-ND3 protein is typically produced with an N-terminal His tag and expressed in E. coli expression systems . Similar production methods are likely employed for the Oncorhynchus keta version, though specific details are not provided in the available research.

The functional significance of MT-ND3 across different species highlights its evolutionary conservation and importance in cellular energy metabolism. The evidence of positive selection in salmon species, particularly in arctic populations, suggests adaptive advantages that may be linked to environmental pressures such as temperature .

Future Research Directions

Current research on Recombinant Oncorhynchus keta NADH-ubiquinone oxidoreductase chain 3 paves the way for several promising research directions. The evidence of positive selection acting on this gene in salmon species suggests that further investigation into its role in adaptation to different thermal environments could yield valuable insights into how these fish respond to varying environmental conditions, including potential impacts of climate change .

Additionally, detailed structural analyses using advanced techniques such as cryo-electron microscopy could provide more precise information about how MT-ND3 integrates into Complex I and contributes to its function. Such structural data would complement existing kinetic studies and help elucidate the molecular mechanisms underlying the coupling of electron transfer to proton translocation .

The availability of recombinant forms of this protein from commercial suppliers facilitates these research endeavors, making it possible for laboratories worldwide to contribute to our understanding of this important mitochondrial protein and its role in cellular energy metabolism.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format that is currently in stock. However, if you have a specific format preference, please indicate your requirement in the order notes, and we will prepare the product accordingly.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal use, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer components, temperature, and protein stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
MT-ND3; MTND3; NADH3; ND3; NADH-ubiquinone oxidoreductase chain 3; NADH dehydrogenase subunit 3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-116
Protein Length
full length protein
Species
Oncorhynchus keta (Chum salmon) (Salmo keta)
Target Names
Target Protein Sequence
MNLITTIITITITLSAVLATISFWLPQISPDAEKLSPYECGFDPLGSARLPFSLRFFLIA ILFLLFDLEIALLLPLPWGDQLSTPTLTLIWSTAVLALLTLGLIYEWTQGGLEWAE
Uniprot No.

Target Background

Function
This protein is a core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) and is believed to be part of the minimal assembly necessary for enzymatic activity. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.
Protein Families
Complex I subunit 3 family
Subcellular Location
Mitochondrion membrane; Multi-pass membrane protein.

Q&A

What is MT-ND3 and what is its role in mitochondrial function?

MT-ND3 (mitochondrially encoded NADH:ubiquinone oxidoreductase core subunit 3) is an essential component of Complex I (NADH:ubiquinone oxidoreductase) of the mitochondrial electron transport chain. It is encoded by mitochondrial DNA and plays a crucial role in the first step of the respiratory chain by catalyzing electron transfer from NADH to ubiquinone. This process is fundamental to cellular energy production through oxidative phosphorylation, ultimately leading to ATP synthesis. MT-ND3 is also known by several synonyms including NAD3, NADH-ubiquinone oxidoreductase chain 3, and ND3 .

How does MT-ND3 from Oncorhynchus keta (chum salmon) differ from human MT-ND3?

While both human and Oncorhynchus keta MT-ND3 serve similar functions in the mitochondrial electron transport chain, there are notable differences in their genetic sequences that reflect evolutionary divergence. Comparing the aligned DNA sequences of the mitochondrial ND3 gene across species shows conservation of functional domains alongside species-specific variations . These differences can provide valuable insights into evolutionary adaptation of mitochondrial function across vertebrate lineages. Research has demonstrated that fish species like Oncorhynchus keta may exhibit structural modifications in respiratory complex proteins that reflect adaptation to different temperature environments and metabolic requirements compared to mammals.

What techniques are commonly used to express recombinant MT-ND3 protein?

Expression of recombinant MT-ND3 typically involves:

  • Gene amplification using PCR with specific primers designed for the MT-ND3 region (similar to methods used in sequencing studies of the ND3 gene in Oncorhynchus species)

  • Cloning into appropriate expression vectors

  • Transformation into expression systems (bacterial, yeast, or insect cell lines)

  • Induction of protein expression

  • Purification using affinity chromatography, typically with histidine tags

For optimal expression of functionally active protein, researchers often need to carefully consider codon optimization for the host expression system, as hydrophobic membrane proteins like MT-ND3 can be challenging to express in soluble form. Some specialized suppliers like CUSABIO TECHNOLOGY LLC provide ready-to-use recombinant proteins that have undergone quality control testing .

How can researchers evaluate MT-ND3 function in mitochondrial Complex I activity assays?

Complex I activity can be assessed through spectrophotometric assays that measure NADH:ubiquinone oxidoreductase activity. The methodology typically involves:

  • Isolation of mitochondria from tissue samples

  • Preparation of mitochondrial lysates

  • Measurement of NADH oxidation rate spectrophotometrically (340 nm) in the presence of ubiquinone

  • Calculation of activity by determining the rate of NADH oxidation that is sensitive to Complex I inhibitors like rotenone

For MT-ND3 functional studies, researchers can compare wild-type activity with samples containing mutated or modified MT-ND3. In studies of mitochondrial function, two different high molecular weight NADH dehydrogenases can be characterized by native PAGE and detected by direct in-gel activity staining . Additionally, researchers can measure NADH:ferricyanide dehydrogenase activities with different sensitivities to inhibitors like rotenone, piericidin, and diphenyl iodonium to distinguish between different types of NADH dehydrogenase activities .

What methods are recommended for detecting MT-ND3 mutations and quantifying heteroplasmy levels?

Detection of MT-ND3 mutations requires:

  • DNA extraction from relevant tissues (blood, muscle, cultured cells)

  • PCR amplification of the MT-ND3 region

  • Sequencing methods:

    • Sanger sequencing for known mutation sites

    • Whole-genome sequencing for novel mutation discovery

    • Targeted mitochondrial ultra-deep sequencing for increased sensitivity

For quantifying heteroplasmy (the mixture of wild-type and mutant mtDNA), qPCR using mutation-specific primers is highly effective. This approach requires:

  • Design of primers specific to both mutant and wild-type sequences

  • Generation of standard curves using cloned mutant and wild-type amplicons

  • Quantitative PCR with SYBR green dye

  • Calculation of mutant load percentage

This methodology has been successfully used to quantify heteroplasmic levels of MT-ND3 mutations across different tissues, as demonstrated in studies of novel mutations like m.10134C>A in MT-ND3 . Last-cycle hot PCR can also provide accurate quantification of mutant mtDNA percentages in different tissue samples .

What are the established protocols for studying the impact of MT-ND3 on ATP production?

Studying MT-ND3's impact on ATP production involves measuring oxidative phosphorylation capacity in isolated mitochondria or cells:

  • Sample preparation:

    • Isolation of mitochondria from relevant tissues

    • Preparation of permeabilized cells or tissue fibers

  • Measurement techniques:

    • Luciferase-based ATP production assays using various substrates that feed into Complex I

    • Oxygen consumption measurements using high-resolution respirometry

    • Membrane potential assessments using fluorescent probes

  • Comparative analysis:

    • Comparing wild-type samples with those carrying MT-ND3 mutations

    • Assessing ATP production with different substrate combinations

Research has shown that mutations in MT-ND3 can lead to significant reduction in Complex I respiratory chain activity and decreased ATP production for all substrates used by Complex I . For example, in cases of novel MT-ND3 mutations associated with sensorimotor axonal polyneuropathy, biochemical investigations have revealed compromised bioenergetic function in affected tissues .

How do genetic variations in MT-ND3 contribute to species-specific adaptations in Oncorhynchus?

Genetic variations in MT-ND3 across Oncorhynchus species reflect evolutionary adaptations to different environmental conditions:

  • Sequence alignment analysis of the complete ND3 gene across Oncorhynchus species reveals conservation patterns and species-specific variations

  • Comparison of nucleotide substitution rates between species can indicate selective pressures

  • Correlation of specific variations with environmental factors (temperature, altitude, etc.)

Research on mitochondrial genes in salmonids has demonstrated that the ratio of replacement to silent nucleotide substitutions within species compared to between species can provide insights into the selective forces acting on these genes . Studies of nonneutral mitochondrial DNA variation in humans and chimpanzees have shown higher ratios of replacement to silent nucleotide substitutions within species than between species, suggesting that many mitochondrial protein polymorphisms may be slightly deleterious . Similar patterns may exist in fish species and could be explored through comparative genomics approaches.

What methods can be used to investigate the structural interactions between MT-ND3 and other Complex I subunits?

Advanced structural biology techniques to study MT-ND3 interactions include:

  • Cryo-electron microscopy (cryo-EM) of purified Complex I

  • Cross-linking mass spectrometry (XL-MS) to identify subunit contact points

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS) to map protein-protein interfaces

  • Molecular dynamics simulations based on resolved structures

  • Site-directed mutagenesis of predicted interaction sites followed by functional assays

When investigating MT-ND3's role in Complex I assembly and stability, researchers can use blue native PAGE to separate intact complexes, followed by western blotting with antibodies against specific subunits. Studies have shown that the 39 kDa subunit of Complex I can be detected using antibody cross-reactivity, which can help identify multisubunit complexes containing MT-ND3 .

How can researchers distinguish pathogenic MT-ND3 mutations from neutral polymorphisms?

Distinguishing pathogenic mutations from neutral polymorphisms requires multiple lines of evidence:

CriteriaMethodologySignificance
Conservation analysisMultiple sequence alignment across speciesMutations in highly conserved regions are more likely pathogenic
Heteroplasmy levelsqPCR quantification in different tissuesHigher heteroplasmy in affected tissues supports pathogenicity
Segregation with diseaseFamily studiesCo-segregation strengthens evidence for pathogenicity
Functional impactBiochemical assays (Complex I activity, ATP production)Measurable defects in mitochondrial function indicate pathogenicity
Structural analysisModeling of mutation impact on protein structureDisruption of critical domains or interactions suggests pathogenicity
Absence in controlsPopulation database screeningAbsence or extreme rarity in healthy individuals supports pathogenicity

For example, a novel m.10134C>A mutation in MT-ND3 was established as pathogenic through multiple lines of evidence: it was absent in healthy controls, caused significant reduction in Complex I activity, decreased ATP production, and showed tissue-specific heteroplasmy patterns consistent with the clinical phenotype . Additionally, the loss of heteroplasmy in blood, cultured fibroblasts, and myoblasts, along with normal respiratory chain activity in tissues without the mutation, further supported its pathogenicity .

What are the key considerations when designing experiments to study MT-ND3 function across different species?

When studying MT-ND3 function across species, researchers should consider:

  • Primer design: Create primers that anneal to conserved regions flanking the ND3 gene. Studies of the ND3 gene in Oncorhynchus species have successfully used specific primers for gene amplification and sequencing .

  • Sample preparation: Different tissue types may require modified extraction protocols. Mitochondria-rich tissues (muscle, liver, heart) often yield better results for mitochondrial protein studies.

  • Temperature optimization: Enzymes from species adapted to different temperature ranges (like cold-water fish versus mammals) may require adjusted assay conditions to reflect physiological relevance.

  • Controls: Include closely related species as comparators to distinguish species-specific versus genus-level functional characteristics.

  • Data normalization: Standardize results against appropriate housekeeping genes or proteins that show consistent expression across the species being studied.

How can researchers address challenges in expressing functional recombinant MT-ND3?

MT-ND3 expression presents several challenges due to its hydrophobic nature and mitochondrial origin:

  • Expression system selection:

    • Bacterial systems may require fusion partners to improve solubility

    • Yeast systems can provide a eukaryotic environment more suitable for mitochondrial proteins

    • Insect cell systems often yield better results for membrane proteins

  • Codon optimization: Adjust codons to match the preferred usage of the expression host while maintaining the amino acid sequence.

  • Inclusion body recovery: Develop refolding protocols if the protein forms inclusion bodies in bacterial systems.

  • Detergent screening: Test multiple detergents to identify optimal conditions for extracting and maintaining protein stability.

  • Functional validation: Develop activity assays that can confirm proper folding and function of the recombinant protein.

Commercial suppliers like CUSABIO TECHNOLOGY LLC have established protocols for producing recombinant Oncorhynchus keta MT-ND3, suggesting that despite challenges, successful expression is achievable with optimized methods .

What are the most sensitive methods for detecting subtle functional changes in MT-ND3 variants?

For detecting subtle functional changes in MT-ND3 variants, consider these high-sensitivity approaches:

  • High-resolution respirometry: Measures oxygen consumption in intact mitochondria with high precision, allowing detection of minor changes in respiratory capacity.

  • Fluorescence-based assays: NADH and FAD autofluorescence can be used to evaluate mitochondrial electron transport chain function. Studies have demonstrated inversely directed changes in FAD and NADH fluorescence intensity under normal functioning of the electron transport chain .

  • Supercomplex analysis: Blue native PAGE combined with in-gel activity assays can reveal changes in how Complex I associates with other respiratory complexes.

  • Mitochondrial membrane potential measurements: Using potential-sensitive dyes with flow cytometry or microscopy to quantify subtle changes in energization.

  • Proteomics approaches: Mass spectrometry-based analyses can detect altered post-translational modifications or protein-protein interactions.

  • Calcium handling assays: Energy-dependent Ca²⁺ accumulation in mitochondrial matrix is associated with changes in NADH and FAD fluorescence, providing an indirect measure of MT-ND3 function .

How should researchers interpret contradicting results between in vitro and in vivo studies of MT-ND3 function?

When faced with contradicting results between in vitro and in vivo studies:

  • Consider tissue heteroplasmy: MT-ND3 mutations may show different heteroplasmy levels across tissues, leading to variable functional impacts. For example, studies have shown that cultured myoblasts might not carry the same mutation found in skeletal muscle, resulting in normal respiratory chain activity measurements in the cultured cells despite significant deficiencies in the original tissue .

  • Evaluate assay conditions: In vitro conditions may not accurately reflect the cellular environment, particularly regarding factors like pH, ion concentrations, and the presence of regulatory molecules.

  • Assess compensation mechanisms: In vivo systems may activate alternative pathways to compensate for MT-ND3 dysfunction that are absent in simplified in vitro models.

  • Review time-dependent effects: Acute responses in vitro may differ from chronic adaptations that occur in vivo.

  • Consider tissue-specific factors: Nuclear genetic background, mitochondrial density, and metabolic demands vary across tissues and may influence how MT-ND3 variants manifest functionally.

When analyzing such discrepancies, researchers should integrate multiple lines of evidence and consider which model system best represents the biological question being addressed.

What statistical approaches are most appropriate for analyzing MT-ND3 heteroplasmy data across multiple tissues?

For analyzing MT-ND3 heteroplasmy across tissues, these statistical approaches are recommended:

  • Mixed-effects models: Account for within-subject correlations when analyzing heteroplasmy across multiple tissues from the same individuals.

  • Compositional data analysis: Since heteroplasmy represents proportional data (summing to 100%), specialized statistical approaches may be needed.

  • Correlation analyses: Examine relationships between heteroplasmy levels and:

    • Biochemical measurements (Complex I activity, ATP production)

    • Clinical symptoms or phenotypic severity

    • Age and other demographic factors

  • Threshold analysis: Determine if there are tissue-specific threshold effects where symptoms appear only above certain heteroplasmy levels.

  • Longitudinal modeling: For studies tracking heteroplasmy changes over time, time-series analyses can reveal patterns of mitochondrial segregation or selection.

Studies examining novel MT-ND3 mutations have successfully quantified heteroplasmy levels in different tissues using qPCR methods and last-cycle hot PCR, providing important insights into the tissue-specific distribution of mutated mtDNA .

How can researchers effectively compare MT-ND3 functional data across different species models?

When comparing MT-ND3 data across species:

  • Phylogenetic correction: Account for evolutionary relationships when comparing functional metrics to distinguish convergent adaptations from shared ancestry.

  • Temperature normalization: Adjust for the physiological temperature ranges of each species, particularly important when comparing cold-water fish like Oncorhynchus keta with mammals.

  • Relative metrics: Use relative measures (e.g., percent change from baseline) rather than absolute values when comparing across species with different baseline metabolic rates.

  • Structural mapping: Align variations to protein structural features to identify functionally equivalent mutations across species.

  • Enzyme kinetics approach: Compare kinetic parameters (Km, Vmax) rather than raw activity measurements to account for species-specific optimization.

Studies comparing nonneutral mitochondrial DNA variation between species (such as humans and chimpanzees) have revealed higher ratios of replacement to silent nucleotide substitutions within species than between species . Similar approaches could be applied to compare MT-ND3 variants across fish species, including Oncorhynchus keta, to identify patterns of selection and functional conservation.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.