Recombinant Oncorhynchus kisutch NADH-ubiquinone oxidoreductase chain 4L (MT-ND4L)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format preference, please indicate it in your order remarks. We will fulfill your request if possible.
Lead Time
Delivery time may vary based on purchasing method and location. Please consult your local distributor for specific delivery details.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer composition, temperature, and the intrinsic stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us and we will prioritize its development.
Synonyms
MT-ND4L; MTND4L; NADH4L; ND4L; NADH-ubiquinone oxidoreductase chain 4L; NADH dehydrogenase subunit 4L
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-98
Protein Length
full length protein
Species
Oncorhynchus kisutch (Coho salmon) (Salmo kisutch)
Target Names
Target Protein Sequence
MTPVHFSFTSAFILGLMGLAFHRTHLLSALLCLEGMMLSLFIALSLWALQMEATGYSVAP MLLLAFSACEASAGLALLVATARTHGTDRLQSLNLLQC
Uniprot No.

Target Background

Function
This protein is a core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I). It is believed to be part of the minimal assembly required for catalysis. Complex I plays a crucial role in transferring electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is thought to be ubiquinone.
Protein Families
Complex I subunit 4L family
Subcellular Location
Mitochondrion membrane; Multi-pass membrane protein.

Q&A

What is MT-ND4L and what is its fundamental role in mitochondrial function?

MT-ND4L (NADH-ubiquinone oxidoreductase chain 4L) is a core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that belongs to the minimal assembly required for catalysis. It functions in the transfer of electrons from NADH to the respiratory chain, with ubiquinone believed to be the immediate electron acceptor for the enzyme . MT-ND4L is encoded by mitochondrial DNA and represents one of the smallest subunits of Complex I. In Oncorhynchus species, as in other vertebrates, this protein is essential for maintaining proper mitochondrial respiration and energy production through oxidative phosphorylation.

What are the structural characteristics of MT-ND4L in Oncorhynchus kisutch compared to other species?

The MT-ND4L protein in Oncorhynchus kisutch is typically around 98 amino acids in length, similar to that found in related species like Lagenorhynchus albirostris . The protein has a molecular weight of approximately 10.7 kDa . MT-ND4L is highly hydrophobic and contains multiple transmembrane domains, which facilitate its integration into the inner mitochondrial membrane. Based on sequence analyses from related organisms, the protein likely features several conserved regions crucial for electron transport and proton translocation. While the exact sequence in Oncorhynchus kisutch may vary slightly, the functional domains are typically highly conserved across vertebrate species due to their essential role in mitochondrial respiration.

How does MT-ND4L contribute to mitochondrial Complex I assembly and stability?

MT-ND4L is considered part of the minimal assembly required for catalytic function of Complex I . The protein likely plays a critical role in the structural organization of the membrane arm of Complex I. During assembly, MT-ND4L is incorporated into early subcomplexes that form the foundation for the complete Complex I structure. Its integration is essential for proper folding and stability of adjacent subunits. Research suggests that absence or mutations in MT-ND4L can lead to incomplete assembly or destabilization of Complex I, resulting in compromised mitochondrial function. In fish species like Oncorhynchus kisutch, this protein likely follows similar assembly dynamics, though species-specific variations in the assembly process may exist due to evolutionary adaptations to different environmental conditions.

What are the optimal methods for isolating and expressing recombinant MT-ND4L from Oncorhynchus kisutch?

For successful expression of recombinant MT-ND4L from Oncorhynchus kisutch, a cell-free expression system is often the preferred method due to the protein's hydrophobic nature and potential toxicity to host cells . This approach circumvents issues related to membrane insertion, protein folding, and cellular toxicity that commonly occur in traditional expression systems. When designing the expression construct, codon optimization for the expression system is crucial to enhance protein yield. Additionally, incorporating affinity tags (such as His-tags) at either the N- or C-terminus facilitates subsequent purification steps.

For purification, a multi-step approach is recommended: initial isolation via affinity chromatography (using the incorporated tag), followed by size exclusion chromatography to remove aggregates and improve purity. Due to MT-ND4L's hydrophobic nature, all buffers should contain appropriate detergents (such as n-dodecyl-β-D-maltoside or digitonin) to maintain protein solubility and stability. Quality control should include SDS-PAGE and Western blotting to confirm identity and purity, with a target purity of at least 85% .

How can researchers effectively assess the functional activity of recombinant MT-ND4L?

Assessing functional activity of recombinant MT-ND4L requires evaluation of its ability to integrate properly into Complex I and contribute to electron transport activity. The NADH-Ubiquinone Oxidoreductase assay is the standard method for measuring Complex I activity . This spectrophotometric assay monitors the rate of NADH oxidation at 340 nm in the presence of ubiquinone and can be performed using an Aminco DW-2000 Spectrophotometer or similar equipment.

For comprehensive functional assessment, researchers should:

  • Measure NADH oxidation rates in reconstituted proteoliposomes containing the recombinant protein

  • Compare activity with and without specific Complex I inhibitors (such as rotenone)

  • Assess proton pumping activity using pH-sensitive fluorescent dyes

  • Evaluate membrane potential generation in reconstituted systems

Additionally, complementation studies in MT-ND4L-deficient cell lines can provide evidence of functional integration. These assays should be performed alongside controls, including measurements of citrate synthase activity to normalize for mitochondrial content .

What challenges are specific to working with recombinant MT-ND4L and how can they be overcome?

Working with recombinant MT-ND4L presents several specific challenges due to its properties as a hydrophobic membrane protein. The primary challenges include:

  • Poor expression yields: Due to toxicity and membrane integration issues, expression levels are often low. This can be addressed by using specialized expression systems such as cell-free methods or by expressing the protein as a fusion with solubility-enhancing partners.

  • Protein aggregation: MT-ND4L's hydrophobic nature predisposes it to aggregation. Researchers should optimize detergent conditions carefully, testing multiple detergent types and concentrations. Adding glycerol (10-20%) to storage buffers can also enhance stability.

  • Functional assessment difficulties: As a component of a multi-subunit complex, functional assessment requires reconstitution with other Complex I subunits. Consider using partial reconstitution approaches with key interacting partners rather than attempting full complex assembly initially.

  • Structural stability issues: Maintaining native-like conformation during purification is challenging. Implementing gentle purification procedures with appropriate detergents and performing activity assays quickly after purification can minimize loss of structural integrity.

  • Species-specific variations: Oncorhynchus kisutch MT-ND4L may have particular characteristics that differ from better-studied mammalian counterparts. A thorough sequence analysis and comparison with related species can help predict potential species-specific handling requirements.

How can mitochondrial DNA damage affect MT-ND4L expression and function in Oncorhynchus species?

Mitochondrial DNA (mtDNA) is particularly susceptible to damage from reactive oxygen species (ROS) due to its lack of protective histones and proximity to the inner mitochondrial membrane where ROS are generated . In Oncorhynchus species, mtDNA damage can significantly impact MT-ND4L expression and function through several mechanisms. First, direct mutations in the MT-ND4L gene can lead to altered protein sequences, affecting protein folding, membrane integration, or interaction with other Complex I subunits. Second, large-scale deletions in mtDNA, similar to the human 4977-bp "common" deletion, can result in complete loss of MT-ND4L expression if the deletion spans the gene region .

The consequence of such damage creates a potential vicious cycle where initial mtDNA damage leads to dysfunctional Complex I, which then increases ROS production, causing further mtDNA damage . In fish species, environmental stressors like temperature shifts, hypoxia, or pollutants can accelerate this cycle. Research methodologies to study these effects should include quantification of mtDNA damage using PCR-based assays that can detect deletions and point mutations, alongside functional assessments of Complex I activity using the NADH-Ubiquinone Oxidoreductase method . Correlating the extent of mtDNA damage with changes in Complex I function can provide valuable insights into how environmental stressors affect mitochondrial bioenergetics in Oncorhynchus species.

What role does MT-ND4L play in reproductive biology and egg viability in salmonid species?

MT-ND4L, as a key component of mitochondrial Complex I, plays a crucial role in energy production that directly impacts reproductive biology and egg viability in salmonid species. Studies with rainbow trout (Oncorhynchus mykiss), a close relative of Oncorhynchus kisutch, have demonstrated that egg quality and embryo development are highly dependent on proper mitochondrial function .

The maternal inheritance of mitochondria means that egg mitochondrial function, including MT-ND4L activity, directly influences early embryonic development. Data from rainbow trout research shows significant variation in egg viability across different families, with eyeing rates ranging from below 10% to over 97% . This variation may partly result from differences in mitochondrial function, including potential variations in MT-ND4L expression or activity.

The relationship between MT-ND4L and reproductive success likely involves:

  • Provision of adequate ATP for early developmental processes

  • Regulation of calcium homeostasis during fertilization and early cleavage

  • Management of oxidative stress during rapid cell division

  • Contribution to maternal-to-zygotic transition via interaction with stored maternal mRNAs

Research on this topic should utilize transcriptome analysis approaches similar to those employed in rainbow trout studies, which can reveal correlations between MT-ND4L expression patterns and developmental outcomes . Additionally, careful analysis of stored maternal transcripts is essential, possibly using rRNA removal methods rather than poly(A) retention, as the latter may miss important stored maternal mRNAs with short poly(A) tails .

How does the expression and function of MT-ND4L vary in response to environmental stressors in Oncorhynchus kisutch?

Environmental stressors significantly impact mitochondrial function in fish species, with MT-ND4L potentially serving as an important indicator of mitochondrial adaptation to stress. In Oncorhynchus kisutch, environmental factors such as temperature fluctuations, hypoxia, acidification, and pollutant exposure likely influence MT-ND4L expression and function through several mechanisms.

Temperature stress particularly affects mitochondrial membrane fluidity, which directly impacts the function of membrane-embedded proteins like MT-ND4L. Cold adaptation in salmon species may involve modifications in MT-ND4L structure or expression to maintain electron transport efficiency at lower temperatures. Hypoxic conditions create a challenge for maintaining mitochondrial function, potentially leading to compensatory upregulation of MT-ND4L to maximize oxygen utilization efficiency.

Research methodologies to investigate these responses should include:

These analyses should be performed across different tissues (gill, liver, muscle, heart) to understand tissue-specific responses, as energy demands and mitochondrial abundance vary significantly between tissue types in fish.

What are the most effective protocols for measuring Complex I activity in relation to MT-ND4L function?

The gold standard for measuring Complex I activity in relation to MT-ND4L function is the NADH-Ubiquinone Oxidoreductase assay . This spectrophotometric method directly measures the core electron transfer function that MT-ND4L contributes to within Complex I. For optimal results when working with Oncorhynchus kisutch samples, researchers should follow these methodological considerations:

  • Sample preparation: Tissues or cells should be homogenized in appropriate isotonic buffer containing protease inhibitors. Mitochondrial isolation should be performed using differential centrifugation, with particular attention to maintaining sample temperature at 4°C throughout processing.

  • Assay conditions: The reaction should be performed using an Aminco DW-2000 Spectrophotometer or equivalent, monitoring NADH oxidation at 340 nm . The assay buffer should include physiologically relevant concentrations of NADH (typically 0.1 mM) and ubiquinone (50-100 μM).

  • Controls and normalization: All measurements should be normalized to citrate synthase activity to account for variations in mitochondrial content between samples . Additionally, performing assays with specific Complex I inhibitors (such as rotenone) allows differentiation between Complex I-specific activity and non-specific NADH oxidation.

  • Data analysis: Activity should be expressed as nmol NADH oxidized/min/mg protein. Comparison between experimental groups should utilize appropriate statistical tests, with careful attention to sample size determination to ensure adequate statistical power.

  • Quality control: Multiple technical replicates should be performed, with coefficient of variation below 10% considered acceptable. Regular calibration of spectrophotometric equipment is essential for reliable results.

How can researchers differentiate between normal sequence variants and pathogenic mutations in MT-ND4L?

Differentiating between normal sequence variants and pathogenic mutations in MT-ND4L requires a multi-faceted approach combining bioinformatic analysis, functional studies, and population genetics. Researchers studying Oncorhynchus kisutch MT-ND4L should implement the following methodology:

  • Sequence conservation analysis: Align MT-ND4L sequences across multiple species, focusing particularly on other salmonids. Highly conserved residues are less likely to tolerate variation without functional consequences. Specific attention should be paid to transmembrane domains and residues known to interact with other Complex I subunits.

  • Population frequency assessment: Establish the frequency of variants in healthy populations of Oncorhynchus kisutch from diverse geographical locations. Variants common in healthy populations are less likely to be pathogenic.

  • Structural impact prediction: Use protein modeling tools to predict how amino acid substitutions might affect protein folding, stability, or interaction with other Complex I components. Even though complete crystal structures may not be available for fish MT-ND4L, homology modeling based on related structures can provide valuable insights.

  • Functional studies: The ultimate determination requires assessment of mitochondrial function in samples carrying the variant. This includes:

    • Complex I activity measurements using the NADH-Ubiquinone Oxidoreductase method

    • Oxygen consumption rate determinations

    • Measurement of ROS production

    • Assessment of mitochondrial membrane potential

  • Correlation with phenotypic data: Where possible, correlate variant presence with physiological or reproductive metrics such as growth rate, swimming performance, or egg viability rates .

Variants that significantly reduce Complex I activity, increase ROS production, or correlate with reduced fitness parameters are more likely to be pathogenic rather than benign polymorphisms.

What bioinformatic approaches are most suitable for analyzing MT-ND4L sequence and structural data?

For comprehensive analysis of MT-ND4L sequence and structural data from Oncorhynchus kisutch, researchers should employ a multi-tiered bioinformatic approach. The following methodological framework is recommended:

  • Sequence analysis and alignment:

    • Multiple sequence alignment using MUSCLE or CLUSTAL for comparing MT-ND4L across species

    • Conservation analysis using ConSurf or similar tools to identify functionally important residues

    • Codon usage analysis to identify selection pressures on specific regions of the gene

    • Identification of haplogroups and phylogenetic analysis using MEGA or similar software

  • Structural prediction and analysis:

    • Transmembrane domain prediction using TMHMM or HMMTOP

    • Ab initio and homology-based 3D structure prediction using AlphaFold2 or I-TASSER

    • Molecular dynamics simulations to assess stability of wild-type and variant structures

    • Protein-protein interaction surface prediction focusing on interfaces with other Complex I subunits

  • Functional impact prediction:

    • SIFT and PolyPhen-2 analysis adapted for fish mitochondrial proteins

    • Energy calculation for amino acid substitutions using tools like FoldX

    • Molecular docking simulations to assess interactions with NADH and ubiquinone

  • Population genetics analysis:

    • Calculation of nucleotide diversity (π) and haplotype diversity

    • Tests for selective neutrality (Tajima's D, Fu's Fs)

    • Identification of signatures of selection that might indicate adaptive changes

  • Integration with transcriptomic and proteomic data:

    • Correlation analysis between MT-ND4L variants and expression levels

    • Network analysis to identify co-expression patterns with nuclear-encoded Complex I subunits

These approaches should be implemented using computational pipelines that ensure reproducibility, with careful documentation of all parameters and version numbers for the software used.

How conserved is MT-ND4L across different fish species and what does this tell us about its evolutionary importance?

MT-ND4L shows remarkable conservation across fish species, reflecting its fundamental importance in mitochondrial function. Sequence analysis reveals that the protein typically maintains approximately 98 amino acids in length across various species . Core functional domains, particularly those involved in electron transport and proton pumping, show the highest conservation. When comparing sequences from Oncorhynchus kisutch with other species like rainbow trout (Oncorhynchus mykiss) or even more distant relatives, several patterns emerge:

  • Transmembrane domains show higher sequence conservation than loop regions, reflecting their critical role in maintaining proper protein topology within the membrane.

  • Residues that interact directly with other Complex I subunits or participate in electron transport pathways demonstrate near-universal conservation, indicating their irreplaceable functional roles.

  • The N-terminal and C-terminal regions typically show greater variability, suggesting these regions may be less critical for core function or may have evolved species-specific regulatory roles.

This high degree of conservation highlights the intense purifying selection pressure acting on MT-ND4L, supporting its essential role in cellular energetics. Any significant deviations from the consensus sequence in particular species may indicate adaptation to specific environmental niches or metabolic demands. For example, differences in MT-ND4L between cold-water species like Oncorhynchus kisutch and warm-water fish might reflect adaptations to different temperature regimes affecting mitochondrial membrane fluidity and protein dynamics.

What can be learned from comparing MT-ND4L function between Oncorhynchus kisutch and model organisms?

Comparative analysis of MT-ND4L between Oncorhynchus kisutch and well-studied model organisms provides valuable insights into both conserved functions and species-specific adaptations. While model organisms like zebrafish or mice offer more developed experimental systems, Oncorhynchus kisutch represents an environmentally and economically important species with unique physiological adaptations.

Key comparative insights include:

  • Thermal adaptation mechanisms: Salmon species including Oncorhynchus kisutch must maintain mitochondrial function across varying temperature ranges during migration. Comparing their MT-ND4L structure and function with that of homeothermic mammals or stenothermal fish species can reveal adaptations that maintain Complex I efficiency across temperature ranges.

  • Response to hypoxia: Salmonids encounter varying oxygen conditions during their life cycle. Comparison with hypoxia-tolerant model species can highlight potential adaptations in MT-ND4L that contribute to maintaining electron transport under low-oxygen conditions.

  • Aging and lifespan differences: The dramatic life history of salmon, with substantial energetic investment in migration and reproduction followed by senescence, presents a unique aging model. Comparing MT-ND4L mutations and their effects between salmon and longer-lived model species may provide insights into the role of mitochondrial function in lifespan determination.

  • Methodological translations: Experimental approaches successful in model organisms, such as the NADH-Ubiquinone Oxidoreductase assay for Complex I activity , can be adapted for use in Oncorhynchus kisutch samples with appropriate modifications to account for species-specific biochemical properties.

  • Drug and toxin sensitivity differences: Comparative analysis of how environmental toxins or pharmaceutical compounds affect MT-ND4L function across species can inform both ecological risk assessment and potential therapeutic approaches for mitochondrial disorders.

How do environmental adaptations influence MT-ND4L structure and function in different Oncorhynchus species?

Environmental adaptations have shaped MT-ND4L structure and function across different Oncorhynchus species in response to their diverse habitats and life histories. Comparative analysis reveals several key adaptations:

  • Temperature adaptation: Species inhabiting different thermal ranges show variations in MT-ND4L sequence that likely affect protein flexibility and stability. Cold-adapted species like Oncorhynchus kisutch may feature amino acid substitutions that maintain catalytic efficiency at lower temperatures compared to species from warmer habitats. These adaptations likely involve changes in hydrophobicity patterns and hydrogen bonding networks within the protein structure.

  • Metabolic rate accommodation: Species with different metabolic demands show variations in MT-ND4L that may influence electron transport efficiency. Migratory species like Oncorhynchus kisutch require high-efficiency mitochondrial function to support energetically demanding migrations, potentially selecting for MT-ND4L variants that maximize ATP production per oxygen consumed.

  • Osmoregulatory challenges: Anadromous Oncorhynchus species transition between freshwater and marine environments, requiring mitochondrial adaptations to support the energetic demands of osmoregulation. MT-ND4L variations may contribute to maintaining mitochondrial function despite changing cellular osmotic conditions.

  • Hypoxia tolerance: Species that regularly encounter low-oxygen environments may have MT-ND4L adaptations that help maintain electron transport under hypoxic conditions, possibly through modifications that reduce electron leakage and subsequent ROS formation.

Research methodologies to investigate these adaptations should include comparative sequence analysis across Oncorhynchus species from different environments, functional assays of Complex I activity under varying experimental conditions (temperature, pH, salinity), and correlation of MT-ND4L sequence variants with physiological performance metrics. Transcriptomic analysis similar to that performed in rainbow trout can reveal how MT-ND4L expression patterns vary across species in response to environmental factors .

What are the most promising techniques for studying MT-ND4L protein-protein interactions within Complex I?

The study of MT-ND4L protein-protein interactions within Complex I is advancing rapidly with several promising techniques showing particular utility for research with Oncorhynchus kisutch samples:

  • Crosslinking Mass Spectrometry (XL-MS): This technique allows identification of interaction interfaces by chemically crosslinking proximal amino acid residues followed by mass spectrometric analysis. For MT-ND4L, membrane-permeable crosslinkers with varying spacer lengths are particularly valuable for mapping interactions within the lipid bilayer environment. The methodology requires careful optimization of crosslinking conditions followed by enrichment of crosslinked peptides before MS analysis.

  • Cryo-Electron Microscopy (Cryo-EM): Recent advances have made it possible to resolve membrane protein structures at near-atomic resolution. While technically challenging, Cryo-EM of purified Complex I from Oncorhynchus kisutch could reveal the precise structural arrangement of MT-ND4L and its interactions with neighboring subunits. Sample preparation would require isolation of intact Complex I using gentle detergent solubilization followed by gradient purification.

  • FRET (Förster Resonance Energy Transfer): By tagging MT-ND4L and potential interaction partners with appropriate fluorophores, FRET can detect proximities and conformational changes during catalytic cycles. For applications in Oncorhynchus kisutch, genetic engineering approaches to introduce fluorescent tags must be carefully designed to minimize functional disruption.

  • Hydrogen-Deuterium Exchange Mass Spectrometry (HDX-MS): This technique identifies regions of proteins that are protected from solvent exchange due to protein-protein interactions. For membrane proteins like MT-ND4L, specialized workflows incorporating compatible detergents are required for successful analysis.

  • Computational Approaches: Molecular dynamics simulations and protein-protein docking algorithms can predict interaction interfaces when combined with experimental constraints. These approaches are particularly valuable for generating testable hypotheses about MT-ND4L interactions that can guide targeted experimental validations.

Each of these methods offers complementary information, and a multi-technique approach is likely to provide the most comprehensive understanding of MT-ND4L's interaction network within Complex I.

How might CRISPR-based technologies be applied to study MT-ND4L function in Oncorhynchus kisutch?

  • MitoTALENs and Base Editors: While traditional CRISPR-Cas9 has limitations in mitochondrial applications, engineered TALE nucleases with mitochondrial targeting sequences (mitoTALENs) or cytidine deaminase base editors can be used to introduce specific mutations in MT-ND4L. The methodology involves designing constructs targeting specific MT-ND4L sequences, followed by expression in cell culture systems or early-stage embryos.

  • Nuclear-encoded MT-ND4L Expression: An alternative approach involves CRISPR-mediated integration of a nuclear-encoded version of MT-ND4L (with appropriate mitochondrial targeting sequence) into the nuclear genome. This allows for precise genetic manipulation using standard CRISPR techniques, followed by expression studies to assess complementation of mitochondrial MT-ND4L function.

  • CRISPR Interference for Mitochondrial Transcription Factors: By targeting nuclear-encoded transcription factors that regulate mitochondrial gene expression, researchers can indirectly modulate MT-ND4L expression. This approach requires careful design of guide RNAs targeting specific transcription factors known to regulate mitochondrial genes in fish species.

  • Reporter Systems: CRISPR can be used to integrate reporter constructs responsive to mitochondrial function, allowing indirect assessment of MT-ND4L activity. For example, reporters sensitive to mitochondrial membrane potential or ROS production can serve as proxies for Complex I function.

  • Interspecies Cell Hybrids: Combining CRISPR-modified nuclear backgrounds with mitochondria from different sources can help dissect nuclear-mitochondrial interactions affecting MT-ND4L function. This could involve creating cell lines with nuclear factors from one species and mitochondria (containing MT-ND4L) from Oncorhynchus kisutch.

Implementation of these approaches in Oncorhynchus kisutch will require optimization of delivery methods for the genetic constructs, potentially including microinjection into embryos or development of appropriate cell culture systems from relevant tissues.

What role might MT-ND4L play in mitochondrial-targeted therapeutic approaches for fish health and conservation?

MT-ND4L represents a potential target for mitochondrial-focused interventions aimed at improving fish health and supporting conservation efforts for Oncorhynchus kisutch and related species. Several promising research directions include:

  • Mitochondrial Protectants for Aquaculture: Development of compounds that stabilize Complex I function under stress conditions could improve survival and growth in aquaculture settings. Screening methodologies should include assessment of Complex I activity using the NADH-Ubiquinone Oxidoreductase assay under varying stressors , with successful candidates showing protection of MT-ND4L function and reduced ROS production.

  • Environmental Stress Mitigation: Understanding how environmental pollutants affect MT-ND4L function could inform conservation strategies. Methodological approaches should include exposure studies with measurement of Complex I activity, mtDNA damage assessment, and correlation with physiological parameters. This research could identify priority pollutants for regulatory action based on their impact on mitochondrial function.

  • Reproductive Success Enhancement: Given the critical role of mitochondrial function in egg quality and development, interventions targeting MT-ND4L function might improve reproductive outcomes in conservation breeding programs . Research should focus on characterizing the relationship between MT-ND4L variants/expression and reproductive metrics, followed by development of interventions to optimize mitochondrial function during gametogenesis.

  • Genetic Resource Banking: Preservation of genetic diversity in MT-ND4L and other mitochondrial genes could form part of conservation strategies. Methodologies should include sequencing of MT-ND4L across wild populations to identify diversity hotspots deserving priority conservation.

  • Climate Change Adaptation: As warming waters threaten cold-water species like Oncorhynchus kisutch, understanding how MT-ND4L function responds to temperature stress could inform selection of broodstock with more resilient mitochondrial function for conservation breeding programs.

Implementation of these approaches requires interdisciplinary collaboration between molecular biologists, conservation biologists, and aquaculture specialists, with careful attention to ethical considerations regarding genetic interventions in wild or captive populations.

Data Table: Comparison of MT-ND4L Characteristics Across Species

SpeciesLength (amino acids)Molecular Weight (kDa)Key Structural FeaturesPrimary FunctionResearch Applications
Oncorhynchus kisutch (Coho salmon)~98~10.7Multiple transmembrane domains; highly hydrophobicElectron transport in Complex IAquaculture optimization; environmental adaptation studies
Oncorhynchus mykiss (Rainbow trout)9810.7Similar to O. kisutch; conserved functional domainsElectron transport; reproduction-related energy productionReproductive biology; egg viability research
Nycticebus coucang (Slow loris)9810.7Multiple transmembrane domainsCore subunit of Complex IComparative evolutionary studies
Lagenorhynchus albirostris (White-beaked dolphin)9810.7Highly hydrophobic; multiple membrane-spanning regionsElectron transport from NADH to ubiquinoneMarine mammal comparative studies
Model organisms (e.g., mouse)97-9810.6-10.7Highly conserved functional domainsComplex I assembly and functionMechanism studies; disease modeling

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.