Recombinant Oncorhynchus masou Dynamin-like 120 kDa protein, mitochondrial (opa1)

Shipped with Ice Packs
In Stock

Description

Mitochondrial Dynamics

  • Fusion Regulation: Mediates IMM fusion through GTP hydrolysis-dependent membrane remodeling, working synergistically with mitofusins (MFN1/2) for outer membrane fusion .

  • Cristae Organization: Stabilizes cristae junctions to maintain oxidative phosphorylation efficiency and prevent cytochrome c release during apoptosis .

Apoptosis Modulation

  • Prevents cristae widening under stress, reducing reactive oxygen species (ROS) production and caspase activation .

  • Proteolytic cleavage by OMA1 (as in mammals ) likely converts L-OPA1 to S-OPA1, altering fusion competence and apoptosis sensitivity .

Research Applications

Application AreaExperimental UseCitation Relevance
Mitochondrial DisordersModeling optic atrophy type 1 (DOA) mechanisms
NeurodegenerationStudying RGC protection in glaucoma models
Structural BiologyCryo-EM analysis of membrane remodeling mechanisms
Therapeutic DevelopmentEvaluating splice-switching antisense oligonucleotides (e.g., STK-002)

Limitations and Future Directions

Current gaps in Oncorhynchus masou OPA1 research include:

  1. Lack of isoform-specific functional studies (eight splice variants exist in humans ).

  2. Uncharacterized proteolytic regulation by OMA1 or PARL proteases in salmonids .

  3. Limited data on cardiolipin binding specificity compared to human OPA1 .

Comparative Analysis with Mammalian OPA1

FeatureOncorhynchus masou OPA1Human OPA1 (Q2TA68)
UniProt IDO93248Q2TA68 (Rat), O60313 (Human)
IsoformsUndocumented8 splice variants, L-OPA1/S-OPA1 proteoforms
Disease AssociationNot establishedDominant optic atrophy, Parkinson’s links
Therapeutic TargetingUnreportedSTK-002 antisense oligonucleotide in trials

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please include it in your order remarks. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the protein's intrinsic stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
opa1; Dynamin-like 120 kDa protein, mitochondrial; 120 kDa G protein expressed in motor neurons; Optic atrophy protein 1 homolog; mG120
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
201-971
Protein Length
full length protein
Species
Oncorhynchus masou (Cherry salmon) (Masu salmon)
Target Names
opa1
Target Protein Sequence
AATEAPVTATPEASDKQFKKSSDKEKVDQLQEELLRTQMKYQRMLERLEKENKDLRKVVL QKDEKGIHQRKIKKSLIDMYSEVLDILSDFDSNYNTQDHLPRVVVVGDQSAGKTSVLEMI AQARIFPRGSGEMMTRSPVKVTLSEGPHHVAMFKDSSREFDLGKEEDLAALRHEIELRMR KSVKEGQTVSPETISLSVKGPGIQRMVLVDLPGVISTVTAGMAADTKETIFSISKNYMQN PNAIILCIQDGSVDAEADRHRPGQSNGPAGERTIFVLTKVDLAEKNLASPNRIQQIVEGK LFPMKALGYFAVVTGKGSAGESIDSIKDYEEDFFQNSRLLRDGMLKAHQVTTKNLSLAVS DCFWKMVRESVEQQADAFKASRFNLETEWKNNYPRLRELDRNELFEKAKNEILDEVISLS QVTPKHWEAILQKKLWERVSTHVIENIYLPAAQTMNSGTFNTTVDIKLKQWTDKQLPHKA LEVAWETLQEEFARFMAEYKGKDQDDIFDKLKEAVKDESIKRHKWNERAMDSLRVIQHNA LEDRSITDKPQWDAAIQFMEETLQARLKDTDSVINDMVGPDWKQRWMSWKNRSPEQHTRN ETRNELERLLKLHEDHTAYLANDEVTTVRKNLEGRGVEVDPALIKDTWHQLYRRHFLQKA LQHCNLCRRGFYYYQRHFVDSELECNDVVLFWRIQRMLLITANTLRQQLTNTEVRRLEKN VKEVLEDFGEDNERKVHLITGRRVQLAEDLKKVREIQEKLEAFIEALHKEK
Uniprot No.

Target Background

Function
Dynamin-related GTPase crucial for normal mitochondrial morphology by regulating the balance between mitochondrial fusion and fission. It binds lipid membranes enriched in negatively charged phospholipids, such as cardiolipin, and promotes membrane tubulation. The intrinsic GTPase activity is low but significantly enhanced by interaction with lipid membranes. This protein plays a role in cristae remodeling and cytochrome c release during apoptosis. An inactive form is generated by cleavage at position S1 by oma1 following stress conditions inducing loss of mitochondrial membrane potential, leading to the negative regulation of mitochondrial fusion.
Protein Families
TRAFAC class dynamin-like GTPase superfamily, Dynamin/Fzo/YdjA family
Subcellular Location
Mitochondrion inner membrane; Single-pass membrane protein. Mitochondrion intermembrane space. Mitochondrion membrane.
Tissue Specificity
Strongly expressed in the brain, ovary and skeletal muscle. In the brain, expression of the mRNA was observed specifically in motor neurons, in nucleus oculomotorius, in nucleus valvulae lateralis, in the medulla oblongata and in the spinal cord.

Q&A

What is the primary function of OPA1 in mitochondria?

OPA1 is a mechanochemical GTPase that influences mitochondrial architecture and catalyzes the fusion of the mitochondrial inner membrane. It plays a fundamental role in shaping cristae morphology and maintaining mitochondrial network integrity. The protein embeds itself into cardiolipin-containing membranes through a specialized lipid-binding paddle domain, with a conserved loop that inserts deeply into the bilayer to stabilize interactions with cardiolipin-enriched membranes .

How conserved is OPA1 structure across vertebrate species?

OPA1 function appears highly conserved across diverse species. Studies have demonstrated that human OPA1 (hOPA1) can functionally substitute for mouse OPA1 (mOPA1) and Drosophila OPA1 (dOPA1) . Given this evolutionary conservation, Oncorhynchus masou OPA1 likely shares key structural domains with mammalian homologs, including the GTPase domain, middle domain, and lipid-binding paddle domain, though species-specific variations in sequence may exist, particularly in regulatory regions.

What are the typical expression patterns of OPA1 in fish tissues?

In vertebrates, OPA1 is widely expressed across tissues, with highest levels typically found in metabolically active tissues such as brain, retina, liver, and muscle. Though specific Oncorhynchus masou expression data is limited, researchers should anticipate similar tissue distribution patterns with potentially higher expression in energy-demanding tissues like swimming muscles, neural tissues, and sensory organs, reflecting the protein's critical role in maintaining mitochondrial function.

How does OPA1 dimerization influence its membrane remodeling capacity?

OPA1 dimerization through the paddle domain promotes the helical assembly of a flexible OPA1 lattice on the membrane. This organized structure drives mitochondrial fusion in cells by creating membrane-bending forces. The membrane-bending OPA1 oligomer undergoes conformational changes that pull the membrane-inserting loop out of the outer leaflet, contributing to the mechanics of membrane remodeling . This process likely involves specific residues within the paddle domain that facilitate both protein-protein and protein-lipid interactions.

What role does cardiolipin play in OPA1-membrane interactions?

OPA1 preferentially binds to membranes containing cardiolipin (CL), which enhances its GTPase hydrolysis activity. Specific residues in the docking region, particularly Lys738, Arg857, and Arg858 (in human OPA1), are required for membrane binding. The membrane-insertion loop (MIL) containing residues 770-782 is critical for both membrane binding and remodeling . When working with Oncorhynchus masou OPA1, researchers should consider the conservation of these cardiolipin-binding regions as essential for proper function.

How do proteolytic processing and splicing affect OPA1 function?

In mammals, OPA1 exists in multiple isoforms due to alternative splicing and proteolytic processing. Eight human isoforms are directed to mitochondria via a mitochondrial-targeting sequence (MTS). Inside mitochondria, the MTS is cleaved to produce long-form (L-OPA1), which is anchored to the inner membrane. Regulated proteolysis generates short-form (S-OPA1) lacking the transmembrane domain . Both forms are necessary for balanced mitochondrial network organization. Fish OPA1 likely undergoes similar processing, though the specific proteases and regulatory mechanisms may differ.

What expression systems are optimal for producing recombinant Oncorhynchus masou OPA1?

Based on successful expression systems for other OPA1 homologs, researchers should consider:

Table 3.1: Expression System Comparison for Recombinant OPA1 Production

Expression SystemAdvantagesDisadvantagesPurification Tags
E. coli BL21(DE3)-RIPLHigh yield, cost-effective, rapid growthPotential improper folding, limited post-translational modificationsHis, GST, MBP
HEK293Mammalian post-translational modifications, proper foldingHigher cost, lower yield, slower growthHis-Fc-Avi, His
Insect cellsPost-translational modifications, high yield for complex proteinsModerate cost, technical complexityHis, Strep

For functional studies of Oncorhynchus masou OPA1, mammalian expression systems like HEK293 may provide proteins with more native-like modifications and folding . For structural studies requiring higher yields, E. coli expression followed by careful refolding protocols may be suitable.

What purification strategy yields the highest activity for recombinant OPA1?

Effective purification of recombinant OPA1 typically involves:

  • Cell lysis in buffer containing HEPES-NaOH (pH 7.5), NaCl (500 mM), imidazole (20 mM), MgCl₂ (5 mM), and detergents like CHAPS (5 mM)

  • Initial purification via affinity chromatography (Ni-NTA for His-tagged proteins)

  • Tag removal using appropriate proteases

  • Further purification via size exclusion chromatography

  • Storage in PBS buffer to maintain stability

Critical considerations include maintaining protein stability through addition of glycerol (10%), reducing agents (2-mercaptoethanol), and avoiding repeated freeze-thaw cycles that can compromise activity .

How can researchers assess OPA1 membrane binding and remodeling activity?

Functional assays for OPA1 should evaluate both membrane binding and remodeling capabilities:

  • Liposome co-sedimentation assays: Mix purified OPA1 with cardiolipin-containing liposomes, then ultracentrifuge to separate membrane-bound and soluble fractions. Quantify protein distribution by SDS-PAGE .

  • GTPase activity assays: Measure GTP hydrolysis rates using colorimetric phosphate detection methods, comparing activity with and without cardiolipin-containing membranes.

  • Membrane tubulation assays: Visualize OPA1-mediated membrane deformation using negative-stain electron microscopy or fluorescently labeled liposomes observed via confocal microscopy.

  • FRET-based fusion assays: Monitor membrane fusion events using liposomes labeled with fluorescent donor-acceptor pairs.

Each assay should include appropriate controls, including catalytically inactive mutants (GTPase domain mutations) and membrane-binding deficient variants (paddle domain mutations).

How can mutagenesis studies identify critical residues in Oncorhynchus masou OPA1?

Structure-function studies of OPA1 can be approached through targeted mutagenesis:

  • Align Oncorhynchus masou OPA1 sequence with human OPA1 to identify conserved residues in functional domains

  • Generate point mutations in key regions:

    • GTPase domain (affecting catalytic activity)

    • Membrane insertion loop (MIL) residues corresponding to human W771, K772, R774, W775, and R781

    • Interface residues involved in dimerization

  • Express mutant proteins and assess:

    • Membrane binding (co-sedimentation assays)

    • GTPase activity (phosphate release assays)

    • Membrane remodeling (tubulation assays)

    • Oligomerization state (crosslinking, size exclusion)

Critical residues will show conserved functions across species, while divergent residues may indicate species-specific adaptations in fish mitochondrial dynamics.

What are the challenges in studying OPA1 function in the context of fish-specific physiological adaptations?

Studying Oncorhynchus masou OPA1 presents unique challenges related to fish physiology:

  • Temperature adaptation: Fish mitochondria function across diverse temperature ranges. Researchers should characterize OPA1 activity at temperatures relevant to the species' habitat (typically 4-15°C for salmonids).

  • Metabolic shifts: Migratory fish like Oncorhynchus masou undergo dramatic metabolic changes during life stages that may influence OPA1 regulation and function.

  • Tissue-specific isoforms: Characterize expression patterns of OPA1 splice variants across tissues, particularly in high-energy demand tissues like swimming muscles.

  • Model system development: While mammalian cell lines provide accessibility, they may not recapitulate fish-specific regulatory mechanisms. Consider developing fish cell lines or ex vivo tissue preparations for more physiologically relevant studies.

  • Genome duplication effects: Many fish species experienced genome duplication events, potentially resulting in paralogous OPA1 genes with distinct functions that should be characterized separately.

How can researchers develop fish-specific cell models to study OPA1 function?

To better understand Oncorhynchus masou OPA1 in its native context:

  • Fish cell line utilization: Establish or utilize existing fish cell lines (e.g., RTG-2 from rainbow trout) for expressing tagged OPA1 constructs.

  • CRISPR/Cas9 genome editing: Develop knockout or knockin models in fish cell lines to study OPA1 function or introduce fluorescent tags for live imaging.

  • Primary cell isolation: Isolate primary cells from Oncorhynchus tissues, particularly from metabolically active tissues like muscle or liver, for short-term culture and manipulation.

  • Trans-species complementation: Test functional conservation by expressing Oncorhynchus masou OPA1 in OPA1-deficient mammalian cells or Drosophila models, similar to studies showing human OPA1 can substitute for Drosophila OPA1 .

  • Mitochondrial isolation: Develop protocols for isolating intact mitochondria from Oncorhynchus tissues to study native OPA1 in its physiological context.

What are the most common issues affecting recombinant OPA1 stability and activity?

Table 5.1: Troubleshooting Guide for Recombinant OPA1

IssuePossible CausesSolutions
Low protein yieldPoor expression, protein aggregationOptimize codon usage, lower expression temperature (18°C), add solubility tags
Loss of GTPase activityImproper folding, metal ion depletionInclude MgCl₂ in all buffers, avoid chelating agents, verify protein conformation
Aggregation during storageFreeze-thaw damage, concentration too highAliquot before freezing, maintain glycerol (10%), store at -80°C
Poor membrane bindingDetergent interference, damaged paddle domainReduce/remove detergent before assays, verify structural integrity of lipid-binding regions
Inconsistent activity resultsBatch-to-batch variation, lipid composition differencesStandardize purification protocols, use consistent liposome preparation methods

How should researchers validate the structural integrity of purified OPA1?

Quality control assessments for recombinant Oncorhynchus masou OPA1 should include:

  • Purity assessment: SDS-PAGE with Coomassie staining (target ≥85% purity)

  • Endotoxin testing: LAL method to ensure levels <1.0 EU per μg for cell-based experiments

  • Folding verification:

    • Circular dichroism to confirm secondary structure composition

    • Thermal shift assays to assess stability

    • Limited proteolysis to verify domain organization

  • Functional validation:

    • Basal GTPase activity measurement

    • Cardiolipin-stimulated GTPase enhancement

    • Liposome binding assays

  • Oligomeric state analysis:

    • Size exclusion chromatography

    • Dynamic light scattering

    • Native PAGE

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.