NADH-ubiquinone oxidoreductase chain 3 (MT-ND3) is a mitochondrially encoded protein that functions as a core subunit of Complex I in the electron transport chain. In Oncorhynchus masou, this protein is encoded by the MT-ND3 gene located in the mitochondrial genome. The recombinant form of this protein is artificially produced through expression systems, typically using E. coli bacteria, to enable various research applications and structural-functional studies . MT-ND3 belongs to a family of proteins essential for cellular respiration and energy production, making it a target of interest for evolutionary, physiological, and biochemical investigations focused on salmonid species.
The protein is alternatively known by several synonyms including MTND3, NADH3, and ND3, all referring to the same functional molecule that participates in the mitochondrial respiratory chain . As a component of the minimal assembly required for catalysis in Complex I, MT-ND3 represents a critical element in understanding the mechanisms of energy production in Cherry salmon and related species.
Oncorhynchus masou belongs to the family Salmonidae and is native to the western Pacific Ocean. Understanding the MT-ND3 protein from this species provides valuable comparative data for researchers studying mitochondrial function across different organisms. Similar proteins exist in related species such as Oncorhynchus gorbuscha (Pink salmon) and even in evolutionarily distant organisms like Pisaster ochraceus (purple sea star) .
When compared to MT-ND3 from other species, the Oncorhynchus masou variant shows high sequence conservation with other salmonids, particularly with Oncorhynchus gorbuscha (Pink salmon), which has the following sequence:
MNLITTIITITITLSAVLATISFWLPQISPDAEKLSPYECGFDPLGSARLPFSLRFFLIA ILFLLFDLEIALLLPLPWGDQLNTPTLTLIWSTAVLALLTLGLIYEWTQGGLEWAE
The high degree of similarity between these sequences (with only minor differences) indicates the evolutionary conservation of this protein within the Oncorhynchus genus, suggesting its functional importance. This comparison is presented in Table 1.
| Species | UniProt ID | Length (aa) | Sequence Similarity to O. masou | Key Sequence Differences |
|---|---|---|---|---|
| Oncorhynchus masou | Q37108 | 116 | 100% | Reference sequence |
| Oncorhynchus gorbuscha | P20686 | 116 | >98% | Position 83: A vs T; Position 85: A vs I |
| Pisaster ochraceus | P24997 | 115* | ~70%* | Multiple differences throughout |
| Ornithorhynchus anatinus | Q36456 | 115* | ~60%* | Multiple differences throughout |
*Approximate values based on available sequence data
The MT-ND3 protein plays a critical role in the mitochondrial respiratory chain as part of Complex I (NADH:ubiquinone oxidoreductase). Complex I is the first and largest enzyme complex in the electron transport chain, responsible for transferring electrons from NADH to ubiquinone (coenzyme Q) . This electron transfer is coupled with proton pumping across the inner mitochondrial membrane, contributing to the electrochemical gradient that drives ATP synthesis.
As a core subunit of Complex I, MT-ND3 is believed to be essential for the catalytic activity of the complex. Based on comparative studies with homologous proteins, MT-ND3 is thought to be involved in forming the membrane domain of Complex I and may participate in the conformational changes that couple electron transfer to proton translocation .
The MT-ND3 protein is part of the NADH dehydrogenase complex with the Enzyme Commission (EC) number 1.6.5.3, now reclassified as EC 7.1.1.2 in updated nomenclature . This enzyme catalyzes the following reaction:
NADH + ubiquinone + H⁺ → NAD⁺ + ubiquinol
This reaction represents the initial step in the electron transport chain, where electrons from NADH are transferred to ubiquinone, accompanied by the translocation of protons across the membrane .
The recombinant form of Oncorhynchus masou MT-ND3 is typically produced using bacterial expression systems, most commonly Escherichia coli. The production process involves inserting the gene encoding MT-ND3 into a suitable expression vector, transforming E. coli with this construct, inducing protein expression, and subsequently purifying the recombinant protein .
The recombinant protein is often expressed with affinity tags to facilitate purification. Different commercial preparations may use various tagging strategies. For instance, some preparations may determine the tag type during the production process, while others specifically use N-terminal polyhistidine tags (His-tags) . These tags allow for efficient purification using affinity chromatography while minimally affecting the protein's structure and function.
After expression, the recombinant protein undergoes purification steps to remove cellular components and contaminants. Quality control measures typically include SDS-PAGE analysis to confirm purity (generally >90%) and size verification. The final product is usually provided in a stabilized buffer formulation that maintains protein integrity during storage .
The recombinant MT-ND3 is often provided in a stabilizing buffer to maintain its integrity. Typical buffer compositions include:
Tris-based buffer systems
50% glycerol for solution stability
pH optimization specific to the protein (typically pH 7.5-8.0)
For lyophilized preparations, manufacturers recommend:
Brief centrifugation of the vial before opening
Reconstitution in deionized sterile water to a concentration of 0.1-1.0 mg/mL
Addition of glycerol (5-50% final concentration) for long-term storage
Aliquoting the reconstituted protein to minimize freeze-thaw cycles
The recombinant protein can serve as:
An antigen for antibody production
A standard in immunoassays for detecting MT-ND3 in biological samples
A tool for immunoprecipitation studies to identify interaction partners
The MT-ND3 protein from Oncorhynchus masou provides valuable material for:
Comparative analyses of mitochondrial proteins across different fish species
Evolutionary studies of the respiratory chain components
Investigation of adaptations in energy metabolism among salmonids
The MT-ND3 protein demonstrates varying degrees of conservation across different species, reflecting both functional constraints and evolutionary divergence. Comparing the Oncorhynchus masou variant with those from other species provides insights into the protein's evolution and species-specific adaptations.
The MT-ND3 protein from Oncorhynchus masou shows high sequence similarity with other fish species, particularly within the Salmonidae family. There is moderate conservation with MT-ND3 from more distant vertebrate species such as the platypus (Ornithorhynchus anatinus), and even invertebrates like the purple sea star (Pisaster ochraceus) .
Despite sequence variations, the core functional domains of MT-ND3 tend to be conserved across species, highlighting the fundamental importance of this protein in mitochondrial respiration. The transmembrane domains and residues involved in proton pumping show particularly high conservation, while loop regions display greater variability .
Research on recombinant Oncorhynchus masou MT-ND3 continues to evolve, with several promising directions for future investigations.
As a component of the respiratory chain, MT-ND3 may show adaptations related to environmental conditions faced by Cherry salmon:
Temperature adaptations in protein stability and function
Comparative studies between migratory and non-migratory salmonid species
Effects of environmental stressors on Complex I activity
The recombinant protein could find applications in:
Development of biosensors for mitochondrial function
Screening platforms for compounds affecting mitochondrial respiration
Biomarkers for environmental monitoring in aquatic ecosystems
MT-ND3 (Mitochondrial NADH-ubiquinone oxidoreductase chain 3) is a mitochondrially-encoded protein that forms an essential component of Complex I of the respiratory chain. In Oncorhynchus species, including O. masou (Cherry salmon) and O. kisutch (Coho salmon), MT-ND3 plays a critical role in energy production through oxidative phosphorylation. It functions as a subunit of NADH dehydrogenase, facilitating electron transfer from NADH to ubiquinone, which represents the first step in the mitochondrial electron transport chain.
Studies on transgenic Oncorhynchus masou ishikawae have demonstrated that mutations in MT-ND3 can lead to significant alterations in the NAD+/NADH ratio and affect reactive oxygen species (ROS) levels . These findings highlight the protein's importance in maintaining cellular energy homeostasis and proper mitochondrial function. As part of Complex I, MT-ND3 contributes to the proton-pumping mechanism that establishes the electrochemical gradient necessary for ATP synthesis.
The function of MT-ND3 is particularly significant in the context of fish physiology and energy metabolism, where mitochondrial efficiency directly impacts swimming performance, growth, and adaptation to environmental changes.
MT-ND3 in Oncorhynchus species is a relatively small membrane protein consisting of 116 amino acids. The protein exhibits highly hydrophobic characteristics with multiple transmembrane domains that anchor it within the inner mitochondrial membrane. Its structural features are specialized for its role in the respiratory chain complex.
The primary structure of MT-ND3 reveals several key characteristics:
Multiple hydrophobic regions corresponding to transmembrane helices
Conserved functional domains involved in electron transport
Specific regions that interact with other subunits of Complex I
A structure optimized for integration into the lipid bilayer of the inner mitochondrial membrane
These structural elements position MT-ND3 appropriately for interactions with other Complex I subunits and participation in the electron transport process. While detailed three-dimensional structural information specific to salmon MT-ND3 is limited, research on related NADH-ubiquinone oxidoreductase complexes using techniques such as cryo-electron microscopy has provided insights into how similar subunits are arranged within the complex .
MT-ND3 serves as an integral component of Complex I (NADH:ubiquinone oxidoreductase) in the mitochondrial respiratory chain of fish. This complex catalyzes the transfer of electrons from NADH to ubiquinone, coupled with proton translocation across the inner mitochondrial membrane. The process contributes to establishing the proton gradient necessary for ATP synthesis through oxidative phosphorylation.
Within the respiratory chain, MT-ND3 plays several critical roles:
It forms part of the membrane domain of Complex I, contributing to its structural integrity and proper assembly.
It participates in the electron transfer pathway, which in Complex I follows a specific sequence through multiple redox centers.
It may be involved in the conformational changes that couple electron transfer to proton pumping across the membrane.
Research on transgenic Oncorhynchus masou ishikawae has demonstrated that alterations in mitochondrial genes like MT-ND3 can lead to significant changes in mitochondrial function. These include altered NAD+/NADH ratios, changes in electron transport capacity, and impacts on ROS production . Proteomic analyses using iTRAQ have revealed that MT-ND3 and other Complex I components may be upregulated in response to metabolic demands or as compensatory mechanisms when mitochondrial function is compromised .
Producing functional recombinant MT-ND3 presents significant challenges due to its hydrophobic nature and membrane-embedded characteristics. Based on current research methodologies, several expression systems and optimization strategies have proven effective:
E. coli Expression System:
E. coli has been successfully employed for expressing recombinant MT-ND3 from Oncorhynchus species, as evidenced by the production of His-tagged full-length Oncorhynchus kisutch MT-ND3 . Key considerations for optimal expression include:
Vector Selection: Vectors with strong inducible promoters (e.g., T7) are preferred for controlled expression.
Fusion Tags: N-terminal His-tags facilitate purification while minimizing interference with protein folding and function.
Expression Conditions: Lower temperatures (16-20°C) post-induction often improve proper folding of membrane proteins.
Membrane Extraction: Specialized detergents such as n-dodecyl-β-D-maltoside (DDM) or Triton X-100 are required to solubilize the protein from membranes.
A typical purification strategy involves cell lysis, membrane fraction isolation, detergent solubilization, immobilized metal affinity chromatography using Ni-NTA resin, and potentially size exclusion chromatography for further purification.
For optimal stability, recombinant MT-ND3 should be stored in Tris-based buffer with 50% glycerol at -20°C to -80°C for long-term storage . Working aliquots can be maintained at 4°C for up to one week, but repeated freeze-thaw cycles should be avoided to prevent protein degradation .
Despite these established methods, obtaining high yields of properly folded and functional MT-ND3 remains challenging. Alternative expression systems such as insect cells or cell-free systems may merit investigation for specific research applications requiring higher yields or more native-like folding conditions.
Studies have demonstrated that growth hormone transgenesis in amago salmon (O. masou ishikawae) can induce specific deletion mutations in mitochondrial DNA that are maternally inherited . Mitochondrial DNA sequencing revealed that approximately 28% of the deletion mutations in GH homozygous and hemizygous female-derived mitochondrial DNA occurred in the ND1 gene, which is functionally related to MT-ND3 within Complex I .
These mutations lead to several significant physiological effects:
Altered Redox State: A decreased NAD+/NADH ratio was observed in transgenic fish, indicating reduced mitochondrial function .
Changes in ROS Production: The transgenic fish displayed decreased reactive oxygen species levels, suggesting altered electron transport chain efficiency .
Metabolic Disruption: Homozygous and hemizygous GH-transgenic fish exhibited hypoglycemia, demonstrating systemic metabolic consequences of mitochondrial dysfunction .
Proteomic analyses using iTRAQ have provided further evidence of compensatory mechanisms in response to mitochondrial mutations:
| Complex | Protein | Score | Fold Change |
|---|---|---|---|
| Complex I | NADH-ubiquinone oxidoreductase chain 1 | 31.9 | 2.2 |
| Complex I | NADH-ubiquinone oxidoreductase chain 2 | 88.14 | 2.2 |
| Complex I | NADH-ubiquinone oxidoreductase chain 5 | 41.43 | 2.8 |
| Complex III | Cytochrome b | 0 | 1.9 |
| Complex IV | Cytochrome c | 1542.2 | 2.1 |
| Complex IV | Cytochrome c oxidase subunit 2 | 453.2 | 2.5 |
This upregulation of respiratory chain components suggests complex adaptive responses to maintain energy homeostasis despite compromised mitochondrial function. The relationship between mutations in MT-ND3 and these compensatory mechanisms provides important insights into mitochondrial plasticity and adaptation to genetic perturbations.
Investigating the interactions between MT-ND3 and other components of Complex I requires sophisticated structural and functional analysis techniques. The following approaches have proven most effective for elucidating these complex protein-protein interactions:
Structural Analysis Techniques:
Cryo-Electron Microscopy (Cryo-EM): This technique has revolutionized structural studies of membrane protein complexes, providing high-resolution structures without the need for crystallization. Cryo-EM has been successfully used to determine structures of related NADH:ubiquinone oxidoreductase complexes with and without bound inhibitors . For MT-ND3 interaction studies, cryo-EM can reveal its precise positioning relative to neighboring subunits and conformational changes under different conditions.
Cross-linking Combined with Mass Spectrometry: This approach uses chemical cross-linkers to capture transient interactions between MT-ND3 and neighboring subunits. Subsequent mass spectrometry analysis can identify cross-linked peptides, providing a map of interaction points. The method is particularly valuable for defining the protein interaction network within Complex I.
Functional Analysis Methods:
Site-Directed Mutagenesis: Systematic mutation of key residues in MT-ND3 followed by functional assays can identify amino acids critical for interactions with other subunits. Research on related systems has shown that specific regions, such as N-terminal stretches, can be crucial for interactions and function. For example, studies on Na+-NQR have identified that the N-terminal stretch (e.g., Trp23-Lys54) plays a critical role in regulating ubiquinone reactions .
Inhibitor Binding Studies: Specific inhibitors can be used as probes to identify binding sites and interaction domains. Research has shown that inhibitors like korormicin A bind to specific regions of related subunits, highlighting functional interaction domains . Similar approaches could be applied to study MT-ND3 interactions.
Blue Native PAGE and Proteomic Analysis: These techniques allow analysis of intact complexes and subcomplexes under near-native conditions, helping to understand the assembly and stability of protein interactions involving MT-ND3.
Research on related systems has provided valuable insights that can guide MT-ND3 interaction studies. For instance, in Na+-NQR, specific regions have been identified as important for ubiquinone binding and interactions with other subunits. The N-terminal stretch of related subunits (e.g., Met1-Lys54) has been shown to be critical for these interactions , suggesting similar regions in MT-ND3 might be worth investigating.
MT-ND3, as a component of Complex I in the respiratory chain, plays a fundamental role in energy metabolism. Studies on transgenic Oncorhynchus masou ishikawae provide significant insights into how alterations in MT-ND3 and related subunits affect metabolic parameters at multiple levels:
Research on GH-transgenic amago salmon has revealed several key metabolic alterations related to MT-ND3 function:
Proteomic analyses using iTRAQ have revealed compensatory responses in the respiratory chain components:
| Complex | Protein | Score | Fold Change |
|---|---|---|---|
| Complex I | NADH-ubiquinone oxidoreductase chains | 31.9-88.14 | 2.2-2.8 |
| Complex III | Cytochrome b | 0 | 1.9 |
| Complex IV | Various cytochrome c components | 63.2-1542.2 | 1.6-2.5 |
This upregulation suggests a coordinated response to maintain energy production despite compromised function of certain components like MT-ND3. The transgenic fish models demonstrate that MT-ND3 is not merely a passive component in energy production but plays an active role in metabolic regulation.
These findings highlight the complex relationship between mitochondrial gene function, respiratory chain efficiency, and whole-organism metabolism. The transgenic fish models provide valuable insights into how specific mitochondrial components like MT-ND3 contribute to energy homeostasis, with potential implications for understanding metabolic disorders in various species.
Understanding the relationship between mitochondrial MT-ND3 and bacterial Na+-pumping NADH-ubiquinone oxidoreductase (Na+-NQR) provides valuable evolutionary and functional insights. While MT-ND3 is a component of mitochondrial Complex I (a primarily proton-pumping complex), Na+-NQR represents a distinct respiratory complex found in bacteria that pumps sodium ions rather than protons:
Na+-NQR is a unique respiratory enzyme found in many pathogenic bacteria, including Vibrio cholerae . This bacterial complex catalyzes electron transfer from NADH to ubiquinone while pumping sodium ions across the membrane, creating an electrochemical gradient that drives various cellular processes .
The relationship between mitochondrial Complex I components like MT-ND3 and bacterial Na+-NQR involves several key aspects:
This comparison highlights how different respiratory complexes have evolved to perform similar fundamental functions (electron transfer coupled to ion transport) through distinct structural and mechanistic solutions. While MT-ND3 and Na+-NQR components may not be directly homologous, understanding their functional parallels and evolutionary relationships provides valuable context for research on both systems.
Structural Considerations of Tagged MT-ND3:
Tag Position Effects:
N-terminal His-tags are commonly used for MT-ND3 expression , as this approach appears to minimize disruption of transmembrane domains.
The tag type may need to be determined during the production process to optimize for the specific protein characteristics .
Tags can potentially alter the hydrophobicity profile of the protein, particularly near membrane-spanning regions, affecting protein folding and insertion into membranes.
Functional Implications:
Tags may interfere with the native interactions between MT-ND3 and other Complex I subunits.
Charged tags (like His-tags) can create non-specific metal binding sites or alter the local electrostatic environment.
Tag-induced conformational changes might affect substrate binding or electron transfer efficiency.
Optimization Strategies for Tagged MT-ND3:
To minimize negative impacts of tagging on MT-ND3, several approaches have been developed:
Buffer and Storage Optimization:
Recombinant His-tagged MT-ND3 is typically stored in Tris-based buffer with 50% glycerol at pH 8.0 .
High glycerol concentration (50%) helps maintain protein stability and prevent aggregation during storage.
Storage recommendations include keeping the protein at -20°C/-80°C and avoiding repeated freeze-thaw cycles .
Reconstitution Protocols:
The properties of tagged MT-ND3 must be carefully considered when designing experiments. For applications requiring native-like function, it may be necessary to compare tagged and untagged versions or to incorporate a protease cleavage site to remove the tag after purification. Understanding these considerations ensures more reliable and interpretable results when working with recombinant MT-ND3 in research settings.
Investigating MT-ND3 mutations and their phenotypic effects requires carefully designed experimental approaches that can link molecular changes to functional outcomes. Based on current research methodologies, several experimental designs have proven particularly effective:
Transgenic Fish Models:
Transgenic fish models provide powerful systems for studying MT-ND3 mutations in vivo:
Model Generation and Characterization:
Growth hormone (GH) transgenic amago salmon (Oncorhynchus masou ishikawae) models have been successfully established and characterized .
These models enable comparative studies between homozygous (Tg/Tg) and hemizygous (Tg/+) conditions, as well as wild-type controls .
Transgenic approaches allow for studying the maternal inheritance of mitochondrial mutations across generations .
Comprehensive Phenotyping:
Molecular and Biochemical Approaches:
Mitochondrial DNA Analysis:
Proteomic and Metabolomic Analyses:
Mitochondrial Function Assays:
Respiratory chain complex activity measurements
Oxygen consumption analysis using respirometry
Membrane potential assessments using fluorescent probes
ATP synthesis rate determination
Experimental Controls and Validation:
Robust experimental designs should include:
Appropriate genetic controls (wild-type, heterozygous, homozygous)
Age and sex-matched individuals to control for developmental and gender-specific effects
Multiple independent biological replicates
Validation of key findings using complementary methodologies
Comparative analysis of MT-ND3 across different species provides valuable insights into evolutionary processes, functional constraints, and adaptation mechanisms. The mitochondrial genome, including MT-ND3, has unique characteristics that make it particularly informative for evolutionary studies:
Evolutionary Significance of MT-ND3:
Maternal Inheritance Patterns:
MT-ND3, being encoded in mitochondrial DNA, is maternally inherited without recombination.
This pattern of inheritance makes it useful for tracking evolutionary lineages and population histories.
Studies on transgenic fish have demonstrated how MT-ND3 mutations can be maternally inherited across generations .
Conservation and Variation Patterns:
MT-ND3 shows high sequence conservation in functionally critical regions across species.
Comparing MT-ND3 between Oncorhynchus masou and Oncorhynchus kisutch reveals only minor differences at positions 19 (I vs. V) and 74 (A vs. T) .
These patterns of conservation and variation provide insights into which regions are under strong selective pressure.
Insights from Related Respiratory Systems:
Research on the Na+-pumping NADH:ubiquinone oxidoreductase (Na+-NQR) system, which shares functional similarities with mitochondrial Complex I components like MT-ND3, has revealed important evolutionary mechanisms:
Horizontal Gene Transfer:
Protein Domain Evolution:
Methodological Approaches for Evolutionary Studies:
Sequence Alignment and Phylogenetic Analysis:
Multiple sequence alignment of MT-ND3 from diverse species
Construction of phylogenetic trees to infer evolutionary relationships
Analysis of selection pressures using dN/dS ratios
Structure-Function Correlation:
Mapping conserved regions to functional domains
Identifying species-specific adaptations in protein sequence
Correlating sequence variations with environmental or physiological adaptations
These comparative approaches provide a framework for understanding how MT-ND3 has evolved across different species, particularly within the Oncorhynchus genus, and how these evolutionary changes relate to functional adaptations in energy metabolism. The insights gained can inform both basic evolutionary biology and applied research in areas such as aquaculture genetics and conservation biology.