Recombinant Oncorhynchus mykiss Cytochrome c oxidase subunit 2 (mt-co2)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Oncorhynchus mykiss Cytochrome c Oxidase Subunit 2 (mt-co2)

Cytochrome c oxidase subunit 2 (mt-co2), when derived from Oncorhynchus mykiss (rainbow trout) through recombinant DNA technology, refers to the protein subunit 2 of the cytochrome c oxidase enzyme complex, produced in a host organism different from its native source using genetic engineering techniques. Cytochrome c oxidase (Complex IV) is a crucial component of the mitochondrial electron transport chain, essential for cellular respiration and energy production in eukaryotes . The mt-co2 subunit plays a vital role in the electron transfer process within this complex.

Role and Significance of Cytochrome c Oxidase Subunit 2

Cytochrome c oxidase (COX), located in the inner mitochondrial membrane, catalyzes the final step in the electron transport chain, transferring electrons to oxygen to form water and generating a proton gradient that drives ATP synthesis . The enzyme consists of several subunits, with mt-co2 being a core subunit directly involved in the electron transfer and proton pumping mechanisms.

Recombinant Production

Recombinant production of Oncorhynchus mykiss mt-co2 involves isolating the gene encoding the mt-co2 subunit from Oncorhynchus mykiss, cloning it into an expression vector, and introducing this vector into a host organism (e.g., bacteria, yeast, or mammalian cells) . The host organism then produces the mt-co2 protein, which can be isolated and purified for research or industrial applications.

Applications and Research Findings

  1. Studies of Mitochondrial Dysfunction: Recombinant mt-co2 can be used to study the effects of mutations and variations in this subunit on mitochondrial function. For example, a novel MT-CO2 variant has been associated with cerebellar ataxia and neuropathy, demonstrating the importance of this subunit in neurological health .

  2. Drug Discovery: Understanding the structure and function of mt-co2 can aid in the development of drugs targeting mitochondrial respiration. Since mt-co2 is essential for cellular energy production, it is a potential target for compounds aimed at treating metabolic disorders and cancer .

  3. Enzyme Mechanism and Structure-Function Relationship: Recombinant production allows researchers to produce large quantities of the protein for structural and functional studies. This can provide insights into the enzyme's catalytic mechanism, proton pumping, and interactions with other subunits and regulatory molecules.

  4. Biomanufacturing: Recombinant proteins, including mt-co2, can be produced using CO2_2-based manufacturing systems, which convert CO2_2 into organic molecules that support microbial growth and protein production. Such systems are valuable in space biomanufacturing, where minimizing launched mass is critical .

Tables

PropertyDescription
Protein NameCytochrome c oxidase subunit 2 (mt-co2)
Source OrganismOncorhynchus mykiss (Rainbow trout)
FunctionPart of the cytochrome c oxidase complex, involved in electron transfer and proton pumping in the mitochondrial electron transport chain
Recombinant ProductionExpressed in a host organism (e.g., E. coli, yeast) using genetic engineering techniques
ApplicationsStudies of mitochondrial dysfunction, drug discovery, enzyme mechanism studies, biomanufacturing

Future Directions

Future research directions involving recombinant Oncorhynchus mykiss mt-co2 may include:

  1. Structural Biology: Determining high-resolution structures of the recombinant protein, alone and in complex with inhibitors or substrates, to elucidate its mechanism of action.

  2. Therapeutic Development: Investigating the potential of mt-co2 as a therapeutic target for mitochondrial diseases and cancer.

  3. Biomanufacturing Innovations: Optimizing CO2_2-based manufacturing systems for efficient and sustainable production of recombinant proteins.

  4. Expanding the Understanding of CO2_2 fixation pathways: Further research into CO2_2 fixation pathways could improve the efficiency of biomanufacturing systems that rely on microbial cell factories .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on purchasing method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. Specify your required tag type for preferential development.
Synonyms
mt-co2; coii; coxii; mtco2; Cytochrome c oxidase subunit 2; Cytochrome c oxidase polypeptide II
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-230
Protein Length
full length protein
Species
Oncorhynchus mykiss (Rainbow trout) (Salmo gairdneri)
Target Names
Target Protein Sequence
MAHPSQLGFQDAASPVMEELLHFHDHALMIVLLISTLVLYIIVAMVSTKLTNMYILDSQE IEIVWTVLPAVILILIALPSLRILYLMDEINDPHLTIKAMGHQWYWSYEYTDYEDLGFDS YMVPTQDLVPGQFRLLETDHRMVVPVESPIRVLVSAEDVLHSWAVPSLGVKMDAVPGRLN QTAFIASRPGVFYGQCSEICGANHSFMPIVVEAVPLEHFEKWSTMMLEDA
Uniprot No.

Target Background

Function
Cytochrome c oxidase subunit 2 (COX2) is a component of cytochrome c oxidase (complex IV, CIV), the terminal enzyme in the mitochondrial electron transport chain (ETC). The ETC comprises three multi-subunit complexes (complexes II, III, and IV) that sequentially transfer electrons from NADH and succinate to molecular oxygen, establishing a proton gradient across the inner mitochondrial membrane that drives ATP synthesis. COX2 plays a critical role within complex IV, catalyzing the reduction of oxygen to water. Electrons from reduced cytochrome c (in the intermembrane space) are transferred via the CuA center (in subunit 2) and heme a (in subunit 1) to the binuclear center (BNC), consisting of heme a3 and CuB (in subunit 1). The BNC then reduces molecular oxygen to water, utilizing four electrons from cytochrome c and four protons from the mitochondrial matrix.
Gene References Into Functions
  1. Rainbow trout possess two inducible, functional COX2 genes. PMID: 17471498
Protein Families
Cytochrome c oxidase subunit 2 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

How is recombinant Oncorhynchus mykiss mt-co2 protein typically produced for research applications?

Recombinant Oncorhynchus mykiss mt-co2 protein for research is typically produced using bacterial expression systems, predominantly E. coli. The methodology involves:

  • Gene cloning: The mt-co2 gene (1-230 aa) is cloned into an expression vector with an N-terminal His-tag for purification purposes

  • Expression: The construct is expressed in E. coli under optimized conditions

  • Purification: The protein is purified using affinity chromatography, leveraging the His-tag

  • Quality control: Purity is verified by SDS-PAGE (typically >90% pure)

  • Storage preparation: The purified protein is formulated in a Tris/PBS-based buffer with 6% Trehalose, at pH 8.0

For reconstitution, researchers are advised to centrifuge the vial before opening, reconstitute in deionized sterile water to 0.1-1.0 mg/mL, and add 5-50% glycerol as a cryoprotectant for long-term storage. This reduces protein damage from freeze-thaw cycles, which should be minimized to maintain protein integrity .

What methods are recommended for detecting and quantifying mt-co2 expression in rainbow trout tissues?

Several methodologies have been validated for detecting and quantifying mt-co2 expression in rainbow trout tissues:

MethodApplicationSensitivityAdvantagesConsiderations
RT-PCRGene expression analysisHighSuitable for specific detection of mt-co2 transcriptsRequires careful primer design to ensure specificity
qPCRQuantitative gene expressionVery highAllows precise quantification relative to reference genes (β-actin commonly used)Requires normalization against stable reference genes
MicroarrayGenome-wide expression profilingModeratePermits simultaneous analysis of multiple genesValidated rainbow trout arrays available (e.g., SFA2.0 chip)
Western blottingProtein detectionModerateConfirms translation of the geneRequires specific antibodies

For RNA extraction, flash-freezing of tissue samples followed by extraction with commercially available kits has proven effective. For quantitative PCR, transcript abundance should be normalized to housekeeping genes such as β-actin, which has shown consistent expression in rainbow trout studies .

When designing primers for mt-co2 amplification, researchers should account for the specific sequence characteristics of rainbow trout mt-co2 to avoid cross-reactivity with other cytochrome oxidase subunits .

How does evolutionary conservation of mt-co2 compare between rainbow trout and other species?

The cytochrome c oxidase subunit 2 (mt-co2) shows significant evolutionary conservation across vertebrates due to its essential role in cellular respiration, but with notable lineage-specific variations. Research on COII (another designation for mt-co2) has revealed:

Unlike mammalian systems where oxygen-sensitive isoforms like COX4-2 show hypoxia responsiveness, fish mt-co2 may exhibit different regulatory mechanisms as fish cytochrome c oxidase subunits generally lack the oxygen-responsive elements found in mammals .

What experimental factors should be considered when studying recombinant mt-co2 function in vitro?

When studying recombinant mt-co2 function in vitro, researchers should consider several critical experimental factors:

1. Storage and Handling Conditions:

  • Store recombinant protein at -20°C/-80°C upon receipt

  • Aliquot to avoid repeated freeze-thaw cycles

  • For extended work, maintain working aliquots at 4°C for up to one week

2. Buffer Composition:

  • Optimal buffer is Tris/PBS-based with 6% Trehalose, pH 8.0

  • For reconstitution, use deionized sterile water to 0.1-1.0 mg/mL

  • Add 5-50% glycerol (final concentration) for long-term storage

3. Contamination Prevention:

  • Cell culture studies should consider potential contamination with bacteria, fungi, yeast, viruses, or chemicals

  • Bacterial contamination is particularly concerning with recombinant proteins produced in E. coli systems

  • Consider antibiotic-free systems where possible, as antibiotics can alter gene expression and cellular responses

4. Experimental Design Considerations:

  • Include appropriate positive and negative controls

  • For interaction studies, consider using analytical techniques such as Electrochemical Impedance Spectroscopy (EIS) or Mass Spectrometry (MS)

  • When comparing wild-type and recombinant proteins, account for the effects of fusion tags (e.g., His-tag)

5. Assay-Specific Considerations:

  • For enzymatic activity assays, maintain physiologically relevant conditions (temperature, pH, ionic strength)

  • When studying interactions with other respiratory chain components, consider reconstitution in membrane-like environments

  • For structural studies, optimize protein concentration and purity

How do environmental stressors affect mt-co2 expression and function in rainbow trout?

Environmental stressors significantly impact mt-co2 expression and function in rainbow trout, with different stressors eliciting specific responses:

1. Carbon Dioxide Exposure:
Rainbow trout exposed to elevated CO2 levels show distinct physiological responses that may involve mt-co2:

CO2 ConcentrationPhysiological EffectsPotential mt-co2 Involvement
Control (22.1 ± 2.8 mg/L)Normal growthBaseline mt-co2 function
Medium (34.5 ± 3.8 mg/L)Decreased growth rate, reduced plasma chloridePotential alterations in respiratory chain function
High (48.7 ± 4.4 mg/L)Significantly slower growth, physiological disturbancesPossible compensatory changes in mt-co2 expression

While chronic exposure to high CO2 (24 ± 1 mg/L) does not directly affect survival rates (>97% survival), it impacts growth parameters and may necessitate metabolic adjustments involving the respiratory chain complexes .

2. Hypoxia Response:
Unlike mammalian systems where hypoxia induces substantial changes in cytochrome c oxidase subunit expression, fish cytochrome c oxidase subunits show different patterns:

  • The COX4-2 gene appeared unresponsive to low oxygen conditions in fish models

  • Fish lack the structural features (such as specific cysteine residues) that confer oxygen responsiveness in mammalian orthologs

  • Variations in coordinating ligands of ATP-binding sites in fish may affect regulatory responses to hypoxia

3. Exercise and Energy Allocation:
Swimming exercise in rainbow trout alters energy allocation and affects various metabolic pathways:

  • Sustained swimming can suppress reproductive development in female rainbow trout

  • Microarray analyses of exercised fish reveal changes in expression of cytochrome c oxidase subunits

  • Changes in cytochrome c oxidase expression may reflect shifts in energy allocation between somatic needs and reproduction

What is the role of mt-co2 in rainbow trout adaptation to environmental challenges?

The mt-co2 protein plays a crucial role in rainbow trout adaptation to environmental challenges through several mechanisms:

1. Metabolic Adaptation:
As a key component of the electron transport chain, mt-co2 is central to energy production. During environmental stress, rainbow trout may adjust mt-co2 expression or function to modulate metabolism. For instance, when exposed to different CO2 concentrations, rainbow trout show physiological adaptations that likely involve respiratory chain adjustments to maintain energy homeostasis despite growth rate differences .

2. Thermal Adaptation:
Rainbow trout inhabit environments with varying temperatures, and mt-co2 function must be maintained across this range. The protein sequence of mt-co2 likely contains adaptations that maintain functionality across thermal gradients, similar to observed thermal adaptations in other fish species .

3. Population-Specific Variation:
While specific data for rainbow trout populations is limited in the provided search results, research on other species suggests that interpopulation variation in mt-co2 can be substantial. In marine copepods, interpopulation divergence at the COII locus reached nearly 20% at the nucleotide level with numerous nonsynonymous substitutions, suggesting adaptive evolution to different environments .

4. Coordinated Evolution with Nuclear Genome:
The function of mt-co2 requires interaction with nuclear-encoded respiratory chain components. As such, mt-co2 evolution must be coordinated with the nuclear genome to maintain functional interactions. This co-evolution is particularly important during adaptation to new environments, where compensatory mutations may be necessary to maintain optimal respiratory chain function .

5. Response to Water Quality Parameters:
Studies show that rainbow trout respond physiologically to water quality parameters such as dissolved CO2. While high CO2 exposure (24 ± 1 mg/L) didn't significantly affect survival or growth compared to low CO2 exposure (8 ± 1 mg/L), it did result in tissue-specific pathologies, suggesting adaptive responses to maintain function under varying conditions .

What methodological approaches are recommended for studying mt-co2 interactions with other respiratory chain components?

Studying mt-co2 interactions with other respiratory chain components requires specialized methodologies that account for both the protein's membrane localization and its role in electron transport. Recommended approaches include:

1. Recombinant Protein Production and Purification:

  • Express rainbow trout mt-co2 with appropriate tags (His-tag commonly used)

  • Ensure proper folding through optimized expression conditions

  • Purify using affinity chromatography followed by size exclusion chromatography

  • Verify purity by SDS-PAGE (>90% purity recommended)

2. Interaction Analysis Techniques:

  • Electrochemical Impedance Spectroscopy (EIS): Useful for monitoring electron transfer interactions

  • Mass Spectrometry (MS): Effective for identifying interaction partners and stoichiometric ratios

  • Surface Plasmon Resonance (SPR): Provides real-time binding kinetics

  • Isothermal Titration Calorimetry (ITC): Determines thermodynamic parameters of binding

3. Functional Assays:

  • Oxygen Consumption Measurements: Monitor real-time oxygen consumption rates

  • Enzyme Activity Assays: Measure cytochrome c oxidase activity using reduced cytochrome c as substrate

  • Electron Transfer Kinetics: Assess the rate of electron transfer using spectrophotometric methods

4. Structural Biology Approaches:

  • X-ray crystallography or cryo-EM for detailed structural analysis

  • Protein-protein docking simulations to predict interaction interfaces

  • Site-directed mutagenesis to validate key interaction residues

5. Membrane Reconstitution Systems:
Since mt-co2 is normally membrane-bound, reconstitution into liposomes or nanodiscs can provide a more physiologically relevant environment for functional studies.

6. Gene Expression Analysis:
When studying interactions at the transcriptional level, microarray or RNA-seq approaches can identify coordinated expression of mt-co2 and interacting partners across different tissues or conditions .

What considerations are important when designing mt-co2 gene expression studies in rainbow trout?

When designing mt-co2 gene expression studies in rainbow trout, researchers should consider several critical factors:

1. Experimental Design:

  • Include appropriate biological replicates (minimum n=4-5 per group recommended)

  • Implement dye-swap strategies for microarray experiments to control for dye bias

  • Consider time-course designs to capture dynamic expression changes

  • Include relevant controls (e.g., vehicle-injected and untreated controls)

2. Tissue Selection:

  • Expression can be tissue-specific; select tissues relevant to research question

  • Common tissues include gill, liver, muscle, and anterior head kidney

  • Consider sampling multiple tissues to understand system-wide responses

  • Note that responses may differ significantly between tissues

3. RNA Extraction and Quality Control:

  • Flash-freeze samples immediately upon collection

  • Extract RNA using established protocols that minimize contamination

  • Verify RNA quality (RIN > 8 recommended) before proceeding

  • Process individual samples without pooling to maintain biological variability

4. Normalization Strategy:

  • Select appropriate reference genes for normalization

  • Validated housekeeping genes for rainbow trout include β-actin, EF1-α, and 18S rRNA

  • Test multiple reference genes and select the most stable across experimental conditions

  • Use relative standard curve method for accurate quantification

5. Primer Design for PCR-based Methods:

  • Design primers specific to rainbow trout mt-co2 sequence

  • Test primer efficiency using standard curves (90-110% efficiency recommended)

  • Verify amplification of a single product via dissociation curve analysis

  • Consider potential splice variants or closely related genes

6. Data Analysis Considerations:

  • Apply appropriate statistical tests (account for multiple testing when necessary)

  • Consider false discovery rate (FDR) corrections for microarray data

  • Validate key findings using alternative methods (e.g., validate microarray with qPCR)

  • Use proper software for normalization and statistical analysis

7. Environmental Variables:

  • Control water quality parameters (temperature, pH, dissolved oxygen, CO2)

  • Document feeding regimen and nutritional status

  • Consider seasonal effects on gene expression

  • Account for fish size, age, and reproductive status

How can recombinant mt-co2 be utilized in vaccine development or disease monitoring in aquaculture?

Recombinant mt-co2 from rainbow trout offers several applications in vaccine development and disease monitoring for aquaculture:

1. Vaccine Development Applications:

  • Recombinant Subunit Vaccines: Purified mt-co2 protein can be utilized as a carrier protein for pathogen-specific antigens, enhancing immunogenicity

  • Adjuvant Properties: Mitochondrial proteins can act as damage-associated molecular patterns (DAMPs) that stimulate innate immune responses

  • Peptide Vaccine Design: Conserved epitopes from mt-co2 can be identified for peptide vaccine development

  • Expression System: The established E. coli expression system for recombinant rainbow trout mt-co2 provides a scalable platform for vaccine production

2. Disease Monitoring Applications:

  • Biomarker Development: Changes in mt-co2 expression can serve as biomarkers for fish health and stress conditions

  • Health Assessment Tool: Gene expression profiling that includes mt-co2 can be used in health assessments of wild and farmed fish populations

  • Environmental Impact Monitoring: mt-co2 expression patterns can indicate physiological responses to environmental stressors in aquaculture settings

3. Methodology for Implementation:

  • Gene Expression Analysis: Quantitative PCR targeting mt-co2 can be incorporated into health monitoring protocols

  • Protein-Based Assays: ELISA or other immunoassays using anti-mt-co2 antibodies can detect abnormal protein levels

  • Molecular Profiling: Inclusion of mt-co2 in broader molecular profiling panels that assess immune system responses, pathogen defense, and general stress

Research indicates that molecular profiling approaches that include mitochondrial genes can effectively differentiate between fish health conditions, with principal component analysis (PCA) strongly differentiating good, poor, and bad condition ranks. Such approaches could be adapted to include mt-co2 as part of health assessment protocols in aquaculture settings .

What bioinformatic tools and databases are most valuable for analyzing mt-co2 sequence variations across salmonid species?

For analyzing mt-co2 sequence variations across salmonid species, researchers should utilize several specialized bioinformatic tools and databases:

1. Primary Sequence Databases:

  • UniProtKB/Swiss-Prot: Contains curated mt-co2 entries with functional annotations (e.g., P48171 for Oncorhynchus mykiss mt-co2)

  • GenBank/NCBI: Comprehensive collection of nucleotide sequences and annotations

  • Ensembl: Genome browser with comparative genomics tools for vertebrates

  • ZFIN/SalmoBase: Specialized databases for fish genomics

2. Evolutionary Analysis Tools:

  • PAML: Implements maximum likelihood models of codon substitution to estimate ω (dN/dS ratio)

  • HyPhy: Detects sites under positive selection within specific lineages

  • MEGA: Comprehensive tool for molecular evolutionary genetics analysis

  • MrBayes/BEAST: Bayesian phylogenetic inference tools

3. Sequence Alignment and Visualization:

  • ClustalW/Clustal Omega: Multiple sequence alignment tools

  • MUSCLE: High-accuracy multiple sequence alignment

  • Jalview: Visualization and analysis of multiple sequence alignments

  • Chimera: Molecular visualization software for protein structures

4. Functional Prediction Tools:

  • PolyPhen/SIFT: Predict functional effects of amino acid substitutions

  • ConSurf: Identifies functionally important regions based on evolutionary conservation

  • I-TASSER/AlphaFold: Protein structure prediction tools to model variant effects

  • InterProScan: Functional domain identification and annotation

5. Codon Usage and Selection Analysis:

  • CodeML/PAML: Analyzes selective pressures at codon level

  • DataMonkey: Web interface for multiple selection detection methods

  • SelectionMap: Visualizes selection pressure across protein sequences

  • CodonW: Analyzes codon usage bias

6. Mitochondrial Genome Resources:

  • MitoFish: Database of fish mitochondrial genomes

  • MITOMAP: Human mitochondrial genome database (useful for comparative analysis)

  • MitoZoa: Database of metazoan mitochondrial genomes

When analyzing mt-co2 sequences, researchers should particularly focus on:

  • Conserved functional domains involved in electron transfer

  • Species-specific variations that may represent adaptations

  • Residues involved in interactions with nuclear-encoded subunits

  • Potential sites under positive selection that may contribute to environmental adaptation

How can recombinant mt-co2 contribute to understanding climate change impacts on rainbow trout physiology?

Recombinant mt-co2 can serve as a valuable tool for understanding climate change impacts on rainbow trout physiology through several research applications:

1. Thermal Adaptation Studies:
Recombinant mt-co2 can be used to assess functional differences between mt-co2 variants from populations adapted to different thermal regimes. Climate change is projected to increase water temperatures in many habitats, and mt-co2 function is temperature-dependent. By expressing and characterizing mt-co2 variants under different temperature conditions, researchers can identify molecular adaptations that might confer thermal tolerance .

2. Carbon Dioxide Response Mechanisms:
Rising atmospheric CO2 levels lead to increased dissolved CO2 in aquatic environments. Studies have shown that rainbow trout exposed to different CO2 concentrations exhibit physiological changes:

CO2 Exposure LevelObserved EffectsResearch Application with Recombinant mt-co2
Low (8 ± 1 mg/L)Baseline conditionBenchmark for normal mt-co2 function
Medium (34.5 ± 3.8 mg/L)Decreased growth, altered plasma chlorideAssess mt-co2 functional changes under moderate hypercapnia
High (48.7 ± 4.4 mg/L)Significantly reduced growth, major physiological disturbancesEvaluate compensatory mechanisms and mt-co2 modifications

Recombinant mt-co2 can be used to study how elevated CO2 affects electron transport efficiency and energy production at the molecular level .

3. Hypoxia Response:
Climate change may increase hypoxic events in aquatic environments. While research suggests that fish cytochrome c oxidase subunits like COX4-2 don't respond to hypoxia in the same way as mammalian orthologs, recombinant mt-co2 can help elucidate rainbow trout-specific adaptations to low oxygen conditions .

4. Interactive Effects:
Climate change involves multiple stressors acting simultaneously. Recombinant mt-co2 can be used in experimental systems to investigate how combinations of temperature, CO2, and oxygen levels affect respiratory chain function, providing insights into potential synergistic impacts on energy metabolism .

5. Population Comparison Studies:
By producing recombinant mt-co2 proteins from different rainbow trout populations and comparing their functional properties, researchers can identify genetic adaptations that may confer resilience to climate change stressors, potentially informing conservation and aquaculture breeding programs .

What emerging technologies might enhance our ability to study mt-co2 function in rainbow trout?

Several emerging technologies hold promise for advancing our understanding of mt-co2 function in rainbow trout:

1. CRISPR-Cas9 Gene Editing:
CRISPR-Cas9 technology enables precise genetic modifications in rainbow trout. This could allow:

  • Creation of specific mt-co2 variants to study structure-function relationships

  • Introduction of reporter tags to monitor mt-co2 expression in vivo

  • Development of knockout or knockdown models to assess mt-co2 function

  • Introduction of mt-co2 variants from other species to study adaptive features

2. Single-Cell Transcriptomics:
Single-cell RNA sequencing can reveal cell-type-specific expression patterns of mt-co2 across tissues, providing insights into:

  • Cellular heterogeneity in mt-co2 expression

  • Cell-specific responses to environmental stressors

  • Developmental regulation of mt-co2 expression

  • Co-expression networks involving mt-co2

3. Advanced Protein Structural Analysis:
Cryo-electron microscopy (cryo-EM) and AlphaFold-based structural prediction can provide detailed insights into rainbow trout mt-co2 structure:

  • Visualization of mt-co2 within the complete cytochrome c oxidase complex

  • Identification of species-specific structural adaptations

  • Elucidation of interaction interfaces with other respiratory chain components

  • Molecular mechanisms of electron transfer

4. Metabolic Flux Analysis:
Stable isotope-based metabolic flux analysis can track real-time changes in cellular metabolism:

5. Nanoscale Sensors and Imaging:
Advanced sensors and imaging technologies enable real-time monitoring of respiratory chain function:

  • Fluorescent probes for mitochondrial membrane potential

  • Nanosensors for local oxygen concentration

  • Super-resolution microscopy of mitochondrial dynamics

  • In vivo imaging of mitochondrial function in rainbow trout tissues

6. Integrated Multi-omics Approaches:
Combining genomics, transcriptomics, proteomics, and metabolomics provides a comprehensive view of mt-co2 in cellular function:

  • Correlation between genetic variants and protein function

  • Integration of mt-co2 expression with broader cellular responses

  • Identification of post-translational modifications affecting mt-co2 function

  • Systems biology models of respiratory chain regulation

What are the most significant unresolved questions regarding mt-co2 function in rainbow trout?

Despite considerable research on mitochondrial function in fish, several significant unresolved questions remain regarding mt-co2 function in rainbow trout:

1. Regulatory Mechanisms:

  • How is mt-co2 expression regulated in response to different environmental stressors?

  • What transcription factors and regulatory elements control mt-co2 expression in rainbow trout?

  • Do rainbow trout possess oxygen-responsive elements similar to the ORE (oxygen-responsive element) found in mammals?

  • How does mt-co2 regulation differ from that in mammals, particularly regarding hypoxia responsiveness?

2. Functional Adaptations:

  • What specific amino acid residues in rainbow trout mt-co2 confer adaptation to cold water environments?

  • How do functional properties of mt-co2 differ between wild and domesticated rainbow trout strains?

  • Are there population-specific variants of mt-co2 that confer advantages under particular environmental conditions?

  • What is the functional significance of the extensive interpopulation variation observed in other fish species' mt-co2?

3. Protein-Protein Interactions:

  • How does rainbow trout mt-co2 interact with nuclear-encoded components of the respiratory chain?

  • What chaperones are involved in mt-co2 assembly into the cytochrome c oxidase complex?

  • How do these interactions influence the efficiency of electron transport?

  • What compensatory mechanisms maintain respiratory chain function when mt-co2 is altered?

4. Environmental Response:

  • How does mt-co2 function respond to combined environmental stressors (temperature, CO2, oxygen levels)?

  • What is the molecular basis for rainbow trout adaptation to different CO2 levels?

  • How do seasonal changes affect mt-co2 expression and function?

  • What role does mt-co2 play in the stress response observed in intensive aquaculture conditions?

5. Methodological Challenges:

  • How can we better study membrane-bound proteins like mt-co2 in their native environment?

  • What approaches can overcome the challenges of expressing and purifying functional mitochondrial membrane proteins?

  • How can we develop rainbow trout-specific tools (antibodies, activity assays) for mt-co2 research?

  • What biomarkers can reliably indicate mt-co2 dysfunction in rainbow trout?

6. Evolution and Adaptation:

  • How has mt-co2 co-evolved with nuclear-encoded respiratory chain components?

  • What selective pressures have shaped mt-co2 evolution in salmonids?

  • How does mt-co2 variation contribute to local adaptation in rainbow trout populations?

  • What can comparisons between resident and anadromous forms reveal about mt-co2 adaptation?

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.