Recombinant Oncorhynchus mykiss Myelin proteolipid protein (plp)

Shipped with Ice Packs
In Stock

Description

Recombinant Production Methods

PLP is produced using heterologous expression systems, primarily E. coli and yeast, with variations in tags and purity.

Table 1: Expression Systems Comparison

ParameterE. coli Yeast
TagN-terminal 6xHis His/Tag-Free
Purity>90% (SDS-PAGE) >90% (SDS-PAGE)
FormLiquid (Tris buffer, 50% glycerol) Liquid/lyophilized powder
Storage Stability6 months (liquid), 12 months (lyophilized) Similar, with trehalose additive

Functional Domains and Sequence Analysis

The extracellular domain (150–218aa) is commonly expressed for studies on myelin structure . Full-length PLP (1–258aa) includes transmembrane regions critical for membrane interactions .

Table 2: Domain-Specific Features

DomainRole
ExtracellularMediates lipid bilayer organization and protein-protein interactions
TransmembraneAnchors PLP in myelin membranes
CytoplasmicInvolved in intracellular signaling

Research Applications

PLP is utilized in diverse experimental contexts:

  • Myelin Structure Studies: SDS-PAGE analysis of recombinant PLP elucidates its role in membrane stacking .

  • Disease Models: While trout PLP is not directly used in EAE (Experimental Autoimmune Encephalomyelitis), homologs like murine PLP 139-151 are key in modeling Multiple Sclerosis .

  • Cell Differentiation: Investigated for its regulatory effects on glial cells .

Table 3: Key Research Findings

StudyKey InsightCitation
Cloning of trout PLP (1996)First identification of PLP/DM20 in rainbow trout CNS Tang et al., 1996
EAE Induction via PLP PeptidesDemonstrated PLP’s encephalitogenic potential in autoimmune models McRae et al., 1992

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you require a specific format, please indicate your preference in the order notes. We will accommodate your request if possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer components, temperature, and the intrinsic stability of the protein.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
plp; Myelin proteolipid protein; PLP; DM20; Lipophilin
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-258
Protein Length
full length protein
Species
Oncorhynchus mykiss (Rainbow trout) (Salmo gairdneri)
Target Names
plp
Target Protein Sequence
MFPVRHALLCKALGCYDCCIRCLGAVPYPSLVSTLLCFTGMALFCGCGHEALAHTEVLVE TYFVRNIQDYVILASFIKYFQYVIYGLASFFFLYCILLLAEGFYTTSAVKQTFGEFRSTR CGRCLSLTFIIVTYVLAVIWLAVFAFTAIPSSSSLIWHRPATTSTSWTETTPSINQHGWI CMDARQYGLLPWNAMPGKACGMTLASICKTKEFFVTYDLYIAAFAGAGIALLALFLYVVA TTYNYAVLRFLGRKGLRC
Uniprot No.

Target Background

Function
Myelin proteolipid protein (PLP) is a major myelin protein found in the central nervous system. It plays a crucial role in the formation and maintenance of the multilamellar structure of myelin. PLP may also be involved in neuron and glial cell differentiation.
Database Links

UniGene: Omy.33416

Protein Families
Myelin proteolipid protein family
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Central nervous system. Highest levels in spinal cord and medulla oblongata.

Q&A

What is Recombinant Oncorhynchus mykiss Myelin Proteolipid Protein (PLP)?

Recombinant Oncorhynchus mykiss Myelin Proteolipid Protein (PLP) is a major myelin protein derived from the central nervous system of rainbow trout. It plays a crucial role in the formation and maintenance of the multilamellar structure of myelin. The protein may also be involved in neuron and glial cell differentiation processes. As a recombinant protein, it is produced in expression systems such as E. coli or yeast, typically consisting of the extracellular domain (amino acids 150-218) and available with various tag configurations . The protein has several synonyms, including DM20 and Lipophilin, which reflect its evolutionary relationships and functional characteristics across species .

What are the key structural and biochemical properties of rainbow trout PLP?

Rainbow trout PLP exhibits several important structural and biochemical characteristics:

PropertySpecificationNotes
Molecular Weight9.7-11.7 kDaVaries by expression system and tag presence
Amino Acid SequencePSSSSLIWHRPATTSTSWTETTPSINQHGWICMDARQYGLLPWNAMPGKACGMTLASICKTKEFFVTYDExtracellular domain sequence
Protein LengthExtracellular Domain, 150-218aaPartial protein commonly used in research
SolubilityLiquid form in Tris-based bufferOften with 50% glycerol for stability
Purity>90%As determined by SDS-PAGE
Expression SystemsE. coli or YeastDifferent systems may affect post-translational modifications

The protein structure facilitates its integration into lipid-rich myelin membranes, with the extracellular domain playing a significant role in myelin compaction and stability .

How does rainbow trout PLP compare evolutionarily to PLP in other vertebrates?

Rainbow trout PLP represents an interesting evolutionary stage in the development of myelin proteins. In the evolutionary transition from fish to tetrapods, PLP replaced P0 (an immunoglobulin superfamily adhesion protein) as the most abundant constituent of central nervous system myelin .

Three paralog proteolipids exist in vertebrates from cartilaginous fish to mammals:

  • PLP/DM20/DMα

  • M6B/DMγ

  • Neuronal glycoprotein M6A/DMβ

In fish, DMα and DMγ are coexpressed in oligodendrocytes but are not major myelin components. The true PLP emerged at the root of tetrapod evolution through the acquisition of an enlarged cytoplasmic loop in the evolutionary older DMα/DM20 . This evolutionary recruitment of PLP as the major myelin protein provided oligodendrocytes with enhanced competence to support long-term axonal integrity. The molecular shift from P0 to PLP also correlates with a concentration of adhesive forces at the radial component, creating a new balance between membrane adhesion and dynamics that proved favorable for CNS myelination in higher vertebrates .

What are the optimal expression systems for producing recombinant rainbow trout PLP?

The choice of expression system significantly impacts the properties and functionality of recombinant rainbow trout PLP:

Expression SystemAdvantagesLimitationsOptimization Strategies
E. coli- High yield
- Cost-effective
- Rapid production
- Well-established protocols
- Limited post-translational modifications
- Potential inclusion body formation
- Potential endotoxin contamination
- Use of specialized strains (BL21, Rosetta)
- Optimization of induction parameters
- Addition of solubility tags
- Purification under denaturing conditions if necessary
Yeast- Eukaryotic post-translational processing
- Higher solubility
- Lower endotoxin levels
- Good for secreted proteins
- Lower yield than bacteria
- Longer production time
- More complex media requirements
- Optimized codon usage
- Signal sequence optimization
- Controlled induction protocols
- Multi-step purification strategy

Methodological considerations include:

  • For E. coli expression: Optimize induction temperature (typically 16-25°C), IPTG concentration (0.1-1.0 mM), and induction time (4-16 hours) to maximize soluble protein yield .

  • For yeast expression: Selection of appropriate strain (P. pastoris or S. cerevisiae), optimization of growth media, and induction protocols specific to the promoter system utilized .

  • For both systems: Implementation of a multi-step purification strategy, typically involving affinity chromatography, ion-exchange chromatography, and size exclusion chromatography to achieve >90% purity as verified by SDS-PAGE .

What protocols are recommended for handling and storage of recombinant rainbow trout PLP?

Proper handling and storage are critical for maintaining the structural integrity and functional properties of recombinant rainbow trout PLP:

Reconstitution Protocol:

  • Briefly centrifuge the vial prior to opening to bring contents to the bottom.

  • For lyophilized protein, reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL.

  • Consider adding 5-50% glycerol (final concentration) to improve stability.

  • Aliquot for long-term storage to avoid repeated freeze-thaw cycles .

Storage Recommendations:

  • Store at -20°C/-80°C upon receipt.

  • Working aliquots can be stored at 4°C for up to one week.

  • Protein in liquid form is generally stable for up to 6 months at -20°C/-80°C.

  • Lyophilized powder form remains stable for up to 12 months at -20°C/-80°C .

Critical Considerations:

  • Avoid repeated freeze-thaw cycles as this can significantly degrade protein quality.

  • Consider the buffer composition for downstream applications (Tris/PBS-based buffer with glycerol is standard).

  • For long-term storage of reconstituted protein, maintain in buffer containing 50% glycerol .

How can rainbow trout PLP be used in experimental autoimmune encephalomyelitis (EAE) models?

Rainbow trout PLP represents an alternative to the commonly used mammalian myelin proteins in EAE models. While mammalian PLP (particularly the 139-151 epitope) is widely used for inducing EAE in mice and rats, rainbow trout PLP offers unique comparative research opportunities:

Methodological Approach for PLP-induced EAE:

  • Immunization protocol: Subcutaneous injection of purified rainbow trout PLP or specific peptide epitopes emulsified in Complete Freund's Adjuvant (CFA).

  • Disease monitoring: Regular assessment of clinical signs using standardized scoring systems.

  • Immunological assessment: Analysis of T cell and antibody responses to both the immunizing antigen and potential cross-reactive epitopes .

Comparative Studies Using Fish vs. Mammalian PLP:
Rainbow trout PLP can be used alongside mammalian PLP to investigate:

  • Evolutionary conservation of encephalitogenic epitopes

  • Cross-reactivity of immune responses

  • Differential engagement of B cell responses

Research has shown that while the short PLP 178-191 peptide elicits identical EAE in wild-type and B cell-deficient (μMT) mice, longer PLP constructs that encompass extracellular domains (ECD) demonstrate B cell dependency. This suggests that longer PLP antigens better engage B cells in the immune response .

How do post-translational modifications affect the immunogenicity and function of rainbow trout PLP?

Post-translational modifications, particularly thiopalmitoylation, significantly impact the immunogenicity and functional properties of PLP. This knowledge has important implications for using recombinant rainbow trout PLP in research:

Impact of Thiopalmitoylation:
PLP is naturally acylated by covalent attachment of long chain fatty acids to cysteine residues via thioester linkages. Research has demonstrated that thioacylated PLP peptides can induce greater T cell and antibody responses compared to their non-acylated counterparts . Specifically:

  • Enhanced immunogenicity: Thioacylated PLP lipopeptides induce stronger immune responses to both acylated and non-acylated forms of the peptide.

  • Increased encephalitogenicity: Fatty acid attachment enhances the development and chronicity of experimental autoimmune encephalomyelitis.

  • Linkage specificity: The lability and site of the linkage between peptide and fatty acid appear critical for inducing encephalitogenic CD4+ T cells. Peptides with fatty acids attached via amide linkage at the N-terminus were not encephalitogenic and induced greater proportions of CD8+ cells .

Methodological Considerations for Recombinant Production:
When producing recombinant rainbow trout PLP, researchers should consider:

  • Whether the expression system (E. coli vs. yeast) can reproduce the necessary post-translational modifications

  • The potential need for synthetic modification to incorporate fatty acids at specific cysteine residues

  • How differences in acylation patterns may affect experimental outcomes, particularly in immunological studies

What are the key considerations for experimental design when studying B cell responses to rainbow trout PLP?

B cells play complex roles in PLP-mediated immune responses, and experimental design should carefully consider:

Antigen Length and Epitope Selection:

  • Short peptides (e.g., PLP 178-191) may fail to effectively engage B cells, as evidenced by identical EAE development in wild-type and B cell-deficient mice.

  • Longer PLP constructs encompassing extracellular domains (ECD) demonstrate B cell dependency, as B cell-deficient mice fail to develop EAE when immunized with PLP ECD .

B Cell Function Assessment:

  • Antibody-dependent vs. antibody-independent roles: PLP ECD can induce EAE in mice incapable of secreting antibodies but with functioning B cells, suggesting a predominant antigen presentation role for B cells in this model .

  • Determination of B cell subsets involved: Different B cell populations may have either pathogenic or regulatory functions.

Experimental Controls and Variables:

  • Use of both short peptides and longer PLP constructs to differentiate B cell engagement

  • Inclusion of appropriate B cell-deficient models (μMT mice)

  • Differentiation between antibody-secreting capability and antigen presentation functions

  • Assessment of disease parameters beyond clinical scoring (histopathology, immune profiling)

How can delayed-type hypersensitivity (DTH) assays be utilized to assess immune responses to rainbow trout PLP?

Delayed-type hypersensitivity (DTH) assays provide valuable methodological approaches for assessing in vivo immune responses to PLP:

DTH Protocol for PLP Response Assessment:

  • Immunization phase: Subcutaneous flank injection with rainbow trout PLP or peptide epitopes emulsified in Complete Freund's Adjuvant (CFA).

  • Challenge phase: After a 14-day immunization period, inject the ear pinnae of immunized mice with the same or similar PLP peptide (without CFA) or PBS as control.

  • Measurement: Using an engineer's micrometer, measure ear thickness at 48 hours post-challenge compared to baseline (0 hour) measurements.

  • Analysis: Calculate "delta ear swelling" as the quantitative readout of DTH reactions .

Applications in PLP Research:

  • Comparison of immunogenicity between different PLP epitopes

  • Assessment of cross-reactivity between fish and mammalian PLP epitopes

  • Evaluation of adjuvant effects on PLP-specific immune responses

  • Testing of potential therapeutic interventions to modulate PLP-specific immunity

DTH reactions serve as reliable indicators of cell-mediated immunity and have been extensively used to read out immune responses to CNS myelin antigens, including PLP variants .

How can rainbow trout PLP be used to study the evolution of myelination across vertebrate species?

Rainbow trout PLP represents an excellent model for studying evolutionary aspects of myelination:

Evolutionary Transitions in Myelin Protein Composition:
The protein composition of myelin in the central nervous system changed significantly during vertebrate evolution. At the transition from fish to tetrapods, PLP replaced P0 (an immunoglobulin superfamily adhesion protein) as the most abundant constituent of CNS myelin .

Research Applications:

  • Comparative structural studies between fish and tetrapod PLP to understand functional adaptations

  • Investigation of the enlarged cytoplasmic loop that emerged in tetrapod PLP and its functional significance

  • Analysis of how evolutionary changes in PLP correlate with improvements in CNS myelination efficiency and axonal support

Methodological Approaches:

  • Recombinant expression of both fish PLP and tetrapod PLP for comparative functional studies

  • Creation of chimeric constructs to isolate the contribution of specific domains to functional differences

  • Transgenic studies to evaluate the axonal support capabilities of fish versus tetrapod PLP

  • Structural analysis to compare membrane integration and protein-protein interactions

What unique insights can be gained from studying Oncorhynchus mykiss PLP compared to mammalian models?

Rainbow trout PLP offers several unique research advantages:

Comparative Advantages of Oncorhynchus mykiss PLP:

  • Evolutionary position: Rainbow trout represents an evolutionary stage prior to the emergence of tetrapod-specific PLP features, allowing the study of ancestral myelin protein functions.

  • Structural simplicity: The fish PLP lacks the enlarged cytoplasmic loop found in tetrapods, providing a simplified model for structure-function studies.

  • Differential oligodendrocyte functions: Fish oligodendrocytes exhibit different myelination properties and axonal support capabilities compared to mammalian counterparts .

Research Applications:

  • Investigating the minimum structural requirements for myelin compaction and stability

  • Understanding how evolutionary adaptations in PLP correlate with enhanced CNS function

  • Exploring alternative myelination mechanisms that may have therapeutic relevance

  • Examining the role of specific PLP domains in neuroinflammatory responses

By comparing rainbow trout PLP with mammalian variants, researchers can identify conserved functional domains essential for basic myelin formation versus tetrapod-specific adaptations that enhance long-term axonal support capabilities .

What are common challenges in producing high-quality recombinant rainbow trout PLP and how can they be addressed?

Researchers frequently encounter several challenges when producing recombinant rainbow trout PLP:

ChallengePotential CausesSolutions
Low expression yield- Codon usage bias
- Toxicity to host cells
- Inefficient transcription/translation
- Optimize codon usage for expression system
- Use inducible expression systems
- Optimize culture conditions (temperature, media composition)
- Consider different host strains
Poor solubility/inclusion body formation- Hydrophobic transmembrane domains
- Improper folding
- Aggregation
- Express only extracellular domains
- Lower induction temperature (16-20°C)
- Add solubility enhancers to media
- Use fusion tags (SUMO, MBP, TRX)
- Consider refolding protocols
Degradation during purification- Protease activity
- Oxidation
- Thermal instability
- Add protease inhibitors
- Include reducing agents
- Maintain low temperature during purification
- Minimize processing time
Post-translational modification issues- Limited modification capability in E. coli
- Hyperglycosylation in yeast
- Choose expression system based on required modifications
- Consider chemical modification post-purification
- Use specialized strains with humanized glycosylation

Optimization Strategies:

  • For E. coli expression: Culture at 16-18°C after induction, use lower IPTG concentrations (0.1-0.5 mM), and extend induction time (16-24 hours) to improve soluble protein yield .

  • For purification: Implement a multi-step purification strategy combining affinity chromatography with ion exchange and size exclusion chromatography to achieve >90% purity .

  • For storage stability: Formulate in Tris/PBS-based buffer with 50% glycerol for liquid storage, or use trehalose (6%) for lyophilization .

How should researchers address potential variability in recombinant rainbow trout PLP across different experimental batches?

Batch-to-batch variability can significantly impact experimental reproducibility when working with recombinant proteins:

Sources of Variability:

  • Expression conditions (temperature, induction time, media composition)

  • Purification efficiency and methodology

  • Post-purification handling and storage

  • Analytical methods used for characterization

Standardization Approaches:

  • Analytical characterization: Perform consistent analytical characterization of each batch:

    • SDS-PAGE for purity assessment (>90% standard)

    • Western blot for identity confirmation

    • Mass spectrometry for molecular weight verification

    • Circular dichroism for secondary structure analysis

  • Activity/functionality testing: Develop standardized functional assays:

    • Binding assays to known interaction partners

    • Immunological reactivity with standard antibodies

    • Biophysical stability assays (thermal shift, dynamic light scattering)

  • Reference standards: Maintain well-characterized reference standards:

    • Create a master reference batch with extensive characterization

    • Compare each new batch against the reference using multiple parameters

    • Document acceptance criteria for each quality attribute

  • Documentation practices:

    • Maintain detailed production records for each batch

    • Document all deviations from standard protocols

    • Create certificates of analysis with standardized testing parameters

By implementing these approaches, researchers can minimize the impact of batch-to-batch variability on experimental outcomes and enhance reproducibility across studies.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.