PLP is produced using heterologous expression systems, primarily E. coli and yeast, with variations in tags and purity.
The extracellular domain (150–218aa) is commonly expressed for studies on myelin structure . Full-length PLP (1–258aa) includes transmembrane regions critical for membrane interactions .
| Domain | Role |
|---|---|
| Extracellular | Mediates lipid bilayer organization and protein-protein interactions |
| Transmembrane | Anchors PLP in myelin membranes |
| Cytoplasmic | Involved in intracellular signaling |
PLP is utilized in diverse experimental contexts:
Myelin Structure Studies: SDS-PAGE analysis of recombinant PLP elucidates its role in membrane stacking .
Disease Models: While trout PLP is not directly used in EAE (Experimental Autoimmune Encephalomyelitis), homologs like murine PLP 139-151 are key in modeling Multiple Sclerosis .
Cell Differentiation: Investigated for its regulatory effects on glial cells .
UniGene: Omy.33416
Recombinant Oncorhynchus mykiss Myelin Proteolipid Protein (PLP) is a major myelin protein derived from the central nervous system of rainbow trout. It plays a crucial role in the formation and maintenance of the multilamellar structure of myelin. The protein may also be involved in neuron and glial cell differentiation processes. As a recombinant protein, it is produced in expression systems such as E. coli or yeast, typically consisting of the extracellular domain (amino acids 150-218) and available with various tag configurations . The protein has several synonyms, including DM20 and Lipophilin, which reflect its evolutionary relationships and functional characteristics across species .
Rainbow trout PLP exhibits several important structural and biochemical characteristics:
| Property | Specification | Notes |
|---|---|---|
| Molecular Weight | 9.7-11.7 kDa | Varies by expression system and tag presence |
| Amino Acid Sequence | PSSSSLIWHRPATTSTSWTETTPSINQHGWICMDARQYGLLPWNAMPGKACGMTLASICKTKEFFVTYD | Extracellular domain sequence |
| Protein Length | Extracellular Domain, 150-218aa | Partial protein commonly used in research |
| Solubility | Liquid form in Tris-based buffer | Often with 50% glycerol for stability |
| Purity | >90% | As determined by SDS-PAGE |
| Expression Systems | E. coli or Yeast | Different systems may affect post-translational modifications |
The protein structure facilitates its integration into lipid-rich myelin membranes, with the extracellular domain playing a significant role in myelin compaction and stability .
Rainbow trout PLP represents an interesting evolutionary stage in the development of myelin proteins. In the evolutionary transition from fish to tetrapods, PLP replaced P0 (an immunoglobulin superfamily adhesion protein) as the most abundant constituent of central nervous system myelin .
Three paralog proteolipids exist in vertebrates from cartilaginous fish to mammals:
PLP/DM20/DMα
M6B/DMγ
Neuronal glycoprotein M6A/DMβ
In fish, DMα and DMγ are coexpressed in oligodendrocytes but are not major myelin components. The true PLP emerged at the root of tetrapod evolution through the acquisition of an enlarged cytoplasmic loop in the evolutionary older DMα/DM20 . This evolutionary recruitment of PLP as the major myelin protein provided oligodendrocytes with enhanced competence to support long-term axonal integrity. The molecular shift from P0 to PLP also correlates with a concentration of adhesive forces at the radial component, creating a new balance between membrane adhesion and dynamics that proved favorable for CNS myelination in higher vertebrates .
The choice of expression system significantly impacts the properties and functionality of recombinant rainbow trout PLP:
| Expression System | Advantages | Limitations | Optimization Strategies |
|---|---|---|---|
| E. coli | - High yield - Cost-effective - Rapid production - Well-established protocols | - Limited post-translational modifications - Potential inclusion body formation - Potential endotoxin contamination | - Use of specialized strains (BL21, Rosetta) - Optimization of induction parameters - Addition of solubility tags - Purification under denaturing conditions if necessary |
| Yeast | - Eukaryotic post-translational processing - Higher solubility - Lower endotoxin levels - Good for secreted proteins | - Lower yield than bacteria - Longer production time - More complex media requirements | - Optimized codon usage - Signal sequence optimization - Controlled induction protocols - Multi-step purification strategy |
Methodological considerations include:
For E. coli expression: Optimize induction temperature (typically 16-25°C), IPTG concentration (0.1-1.0 mM), and induction time (4-16 hours) to maximize soluble protein yield .
For yeast expression: Selection of appropriate strain (P. pastoris or S. cerevisiae), optimization of growth media, and induction protocols specific to the promoter system utilized .
For both systems: Implementation of a multi-step purification strategy, typically involving affinity chromatography, ion-exchange chromatography, and size exclusion chromatography to achieve >90% purity as verified by SDS-PAGE .
Proper handling and storage are critical for maintaining the structural integrity and functional properties of recombinant rainbow trout PLP:
Reconstitution Protocol:
Briefly centrifuge the vial prior to opening to bring contents to the bottom.
For lyophilized protein, reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL.
Consider adding 5-50% glycerol (final concentration) to improve stability.
Aliquot for long-term storage to avoid repeated freeze-thaw cycles .
Storage Recommendations:
Store at -20°C/-80°C upon receipt.
Working aliquots can be stored at 4°C for up to one week.
Protein in liquid form is generally stable for up to 6 months at -20°C/-80°C.
Lyophilized powder form remains stable for up to 12 months at -20°C/-80°C .
Critical Considerations:
Avoid repeated freeze-thaw cycles as this can significantly degrade protein quality.
Consider the buffer composition for downstream applications (Tris/PBS-based buffer with glycerol is standard).
For long-term storage of reconstituted protein, maintain in buffer containing 50% glycerol .
Rainbow trout PLP represents an alternative to the commonly used mammalian myelin proteins in EAE models. While mammalian PLP (particularly the 139-151 epitope) is widely used for inducing EAE in mice and rats, rainbow trout PLP offers unique comparative research opportunities:
Methodological Approach for PLP-induced EAE:
Immunization protocol: Subcutaneous injection of purified rainbow trout PLP or specific peptide epitopes emulsified in Complete Freund's Adjuvant (CFA).
Disease monitoring: Regular assessment of clinical signs using standardized scoring systems.
Immunological assessment: Analysis of T cell and antibody responses to both the immunizing antigen and potential cross-reactive epitopes .
Comparative Studies Using Fish vs. Mammalian PLP:
Rainbow trout PLP can be used alongside mammalian PLP to investigate:
Evolutionary conservation of encephalitogenic epitopes
Cross-reactivity of immune responses
Differential engagement of B cell responses
Research has shown that while the short PLP 178-191 peptide elicits identical EAE in wild-type and B cell-deficient (μMT) mice, longer PLP constructs that encompass extracellular domains (ECD) demonstrate B cell dependency. This suggests that longer PLP antigens better engage B cells in the immune response .
Post-translational modifications, particularly thiopalmitoylation, significantly impact the immunogenicity and functional properties of PLP. This knowledge has important implications for using recombinant rainbow trout PLP in research:
Impact of Thiopalmitoylation:
PLP is naturally acylated by covalent attachment of long chain fatty acids to cysteine residues via thioester linkages. Research has demonstrated that thioacylated PLP peptides can induce greater T cell and antibody responses compared to their non-acylated counterparts . Specifically:
Enhanced immunogenicity: Thioacylated PLP lipopeptides induce stronger immune responses to both acylated and non-acylated forms of the peptide.
Increased encephalitogenicity: Fatty acid attachment enhances the development and chronicity of experimental autoimmune encephalomyelitis.
Linkage specificity: The lability and site of the linkage between peptide and fatty acid appear critical for inducing encephalitogenic CD4+ T cells. Peptides with fatty acids attached via amide linkage at the N-terminus were not encephalitogenic and induced greater proportions of CD8+ cells .
Methodological Considerations for Recombinant Production:
When producing recombinant rainbow trout PLP, researchers should consider:
Whether the expression system (E. coli vs. yeast) can reproduce the necessary post-translational modifications
The potential need for synthetic modification to incorporate fatty acids at specific cysteine residues
How differences in acylation patterns may affect experimental outcomes, particularly in immunological studies
B cells play complex roles in PLP-mediated immune responses, and experimental design should carefully consider:
Antigen Length and Epitope Selection:
Short peptides (e.g., PLP 178-191) may fail to effectively engage B cells, as evidenced by identical EAE development in wild-type and B cell-deficient mice.
Longer PLP constructs encompassing extracellular domains (ECD) demonstrate B cell dependency, as B cell-deficient mice fail to develop EAE when immunized with PLP ECD .
B Cell Function Assessment:
Antibody-dependent vs. antibody-independent roles: PLP ECD can induce EAE in mice incapable of secreting antibodies but with functioning B cells, suggesting a predominant antigen presentation role for B cells in this model .
Determination of B cell subsets involved: Different B cell populations may have either pathogenic or regulatory functions.
Experimental Controls and Variables:
Use of both short peptides and longer PLP constructs to differentiate B cell engagement
Inclusion of appropriate B cell-deficient models (μMT mice)
Differentiation between antibody-secreting capability and antigen presentation functions
Assessment of disease parameters beyond clinical scoring (histopathology, immune profiling)
Delayed-type hypersensitivity (DTH) assays provide valuable methodological approaches for assessing in vivo immune responses to PLP:
DTH Protocol for PLP Response Assessment:
Immunization phase: Subcutaneous flank injection with rainbow trout PLP or peptide epitopes emulsified in Complete Freund's Adjuvant (CFA).
Challenge phase: After a 14-day immunization period, inject the ear pinnae of immunized mice with the same or similar PLP peptide (without CFA) or PBS as control.
Measurement: Using an engineer's micrometer, measure ear thickness at 48 hours post-challenge compared to baseline (0 hour) measurements.
Analysis: Calculate "delta ear swelling" as the quantitative readout of DTH reactions .
Applications in PLP Research:
Comparison of immunogenicity between different PLP epitopes
Assessment of cross-reactivity between fish and mammalian PLP epitopes
Evaluation of adjuvant effects on PLP-specific immune responses
Testing of potential therapeutic interventions to modulate PLP-specific immunity
DTH reactions serve as reliable indicators of cell-mediated immunity and have been extensively used to read out immune responses to CNS myelin antigens, including PLP variants .
Rainbow trout PLP represents an excellent model for studying evolutionary aspects of myelination:
Evolutionary Transitions in Myelin Protein Composition:
The protein composition of myelin in the central nervous system changed significantly during vertebrate evolution. At the transition from fish to tetrapods, PLP replaced P0 (an immunoglobulin superfamily adhesion protein) as the most abundant constituent of CNS myelin .
Research Applications:
Comparative structural studies between fish and tetrapod PLP to understand functional adaptations
Investigation of the enlarged cytoplasmic loop that emerged in tetrapod PLP and its functional significance
Analysis of how evolutionary changes in PLP correlate with improvements in CNS myelination efficiency and axonal support
Methodological Approaches:
Recombinant expression of both fish PLP and tetrapod PLP for comparative functional studies
Creation of chimeric constructs to isolate the contribution of specific domains to functional differences
Transgenic studies to evaluate the axonal support capabilities of fish versus tetrapod PLP
Structural analysis to compare membrane integration and protein-protein interactions
Rainbow trout PLP offers several unique research advantages:
Comparative Advantages of Oncorhynchus mykiss PLP:
Evolutionary position: Rainbow trout represents an evolutionary stage prior to the emergence of tetrapod-specific PLP features, allowing the study of ancestral myelin protein functions.
Structural simplicity: The fish PLP lacks the enlarged cytoplasmic loop found in tetrapods, providing a simplified model for structure-function studies.
Differential oligodendrocyte functions: Fish oligodendrocytes exhibit different myelination properties and axonal support capabilities compared to mammalian counterparts .
Research Applications:
Investigating the minimum structural requirements for myelin compaction and stability
Understanding how evolutionary adaptations in PLP correlate with enhanced CNS function
Exploring alternative myelination mechanisms that may have therapeutic relevance
Examining the role of specific PLP domains in neuroinflammatory responses
By comparing rainbow trout PLP with mammalian variants, researchers can identify conserved functional domains essential for basic myelin formation versus tetrapod-specific adaptations that enhance long-term axonal support capabilities .
Researchers frequently encounter several challenges when producing recombinant rainbow trout PLP:
| Challenge | Potential Causes | Solutions |
|---|---|---|
| Low expression yield | - Codon usage bias - Toxicity to host cells - Inefficient transcription/translation | - Optimize codon usage for expression system - Use inducible expression systems - Optimize culture conditions (temperature, media composition) - Consider different host strains |
| Poor solubility/inclusion body formation | - Hydrophobic transmembrane domains - Improper folding - Aggregation | - Express only extracellular domains - Lower induction temperature (16-20°C) - Add solubility enhancers to media - Use fusion tags (SUMO, MBP, TRX) - Consider refolding protocols |
| Degradation during purification | - Protease activity - Oxidation - Thermal instability | - Add protease inhibitors - Include reducing agents - Maintain low temperature during purification - Minimize processing time |
| Post-translational modification issues | - Limited modification capability in E. coli - Hyperglycosylation in yeast | - Choose expression system based on required modifications - Consider chemical modification post-purification - Use specialized strains with humanized glycosylation |
Optimization Strategies:
For E. coli expression: Culture at 16-18°C after induction, use lower IPTG concentrations (0.1-0.5 mM), and extend induction time (16-24 hours) to improve soluble protein yield .
For purification: Implement a multi-step purification strategy combining affinity chromatography with ion exchange and size exclusion chromatography to achieve >90% purity .
For storage stability: Formulate in Tris/PBS-based buffer with 50% glycerol for liquid storage, or use trehalose (6%) for lyophilization .
Batch-to-batch variability can significantly impact experimental reproducibility when working with recombinant proteins:
Sources of Variability:
Expression conditions (temperature, induction time, media composition)
Purification efficiency and methodology
Post-purification handling and storage
Analytical methods used for characterization
Standardization Approaches:
Analytical characterization: Perform consistent analytical characterization of each batch:
Activity/functionality testing: Develop standardized functional assays:
Binding assays to known interaction partners
Immunological reactivity with standard antibodies
Biophysical stability assays (thermal shift, dynamic light scattering)
Reference standards: Maintain well-characterized reference standards:
Create a master reference batch with extensive characterization
Compare each new batch against the reference using multiple parameters
Document acceptance criteria for each quality attribute
Documentation practices:
Maintain detailed production records for each batch
Document all deviations from standard protocols
Create certificates of analysis with standardized testing parameters
By implementing these approaches, researchers can minimize the impact of batch-to-batch variability on experimental outcomes and enhance reproducibility across studies.