Recombinant Oncorhynchus mykiss NADH-ubiquinone oxidoreductase chain 4L (MT-ND4L)

Shipped with Ice Packs
In Stock

Description

Production Methods

Recombinant MT-ND4L is synthesized using multiple expression systems to ensure flexibility in research applications:

Host Systems

  • Escherichia coli: Commonly used for cost-effective, high-yield production .

  • Yeast/Baculovirus/Mammalian Cells: Employed for post-translational modifications or eukaryotic folding requirements .

Expression Tags

  • His-tagged: Facilitates purification via affinity chromatography (e.g., recombinant protein from Oncorhynchus clarkii) .

Key Functional Motifs

  • A conserved valine residue at position 65 (mutations here disrupt electron transport in humans) .

Biochemical Studies

  • Used to investigate mitochondrial dysfunction in metabolic disorders (e.g., obesity, diabetes) .

  • Serves as a model for studying Leber’s Hereditary Optic Neuropathy (LHON)-linked mutations .

Quality Control and Validation

  • Purity Assurance: SDS-PAGE analysis confirms ≥85% purity .

  • Activity Assays: Functional testing via NADH dehydrogenase activity measurements .

Clinical and Evolutionary Insights

  • Disease Relevance: Mutations in MT-ND4L homologs (e.g., human T10663C variant) impair ATP production, linking mitochondrial dysfunction to optic neuropathy .

  • Evolutionary Conservation: Gene overlap between MT-ND4L and MT-ND4 (e.g., in humans) highlights conserved genomic organization across species .

Challenges and Future Directions

  • Expression Optimization: Balancing yield and functionality across host systems remains a technical hurdle .

  • Therapeutic Potential: Further studies may explore MT-ND4L’s role in metabolic syndrome or as a biomarker for mitochondrial diseases .

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement. We will accommodate your request whenever possible.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All protein shipments include standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months under the same conditions.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple use to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
Tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its inclusion.
Synonyms
MT-ND4L; MTND4L; NADH4L; ND4L; NADH-ubiquinone oxidoreductase chain 4L; NADH dehydrogenase subunit 4L
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-98
Protein Length
full length protein
Species
Oncorhynchus mykiss (Rainbow trout) (Salmo gairdneri)
Target Names
Target Protein Sequence
MTPVHFSFTSAFILGLMGLAFHRTHLLSALLCLEGMMLSLFIALSLWALQMEATGYSVAP MLLLAFSACEASAGLALLVATARTHGTDRLQSLNLLQC
Uniprot No.

Target Background

Function

This protein is a core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I). It is considered part of the minimal assembly necessary for enzymatic activity. Complex I facilitates electron transfer from NADH to the respiratory chain, with ubiquinone believed to be the immediate electron acceptor.

Protein Families
Complex I subunit 4L family
Subcellular Location
Mitochondrion membrane; Multi-pass membrane protein.

Q&A

What is the structure and genomic location of MT-ND4L in Oncorhynchus mykiss?

MT-ND4L is a mitochondrially encoded gene found in the mitochondrial DNA of rainbow trout (Oncorhynchus mykiss). Similar to human MT-ND4L, which spans approximately 297 base pairs (from positions 10,469 to 10,765 in human mtDNA), the rainbow trout gene encodes a small hydrophobic protein that forms part of Complex I of the electron transport chain . The gene produces a protein approximately 11 kDa in size with structural similarities to other vertebrate ND4L proteins. The rainbow trout MT-ND4L likely maintains the characteristic hydrophobic transmembrane domain seen in other species, allowing it to anchor within the inner mitochondrial membrane.

What is the functional role of MT-ND4L in mitochondrial metabolism of rainbow trout?

MT-ND4L protein functions as an essential subunit of NADH dehydrogenase (Complex I) in the mitochondrial electron transport chain of rainbow trout. This complex catalyzes the first step in electron transport, transferring electrons from NADH to ubiquinone . The process creates an electrochemical gradient across the inner mitochondrial membrane that drives ATP synthesis through oxidative phosphorylation . In rainbow trout, this function is particularly important for energy production in high-energy-demanding tissues like swimming muscles and during early developmental stages when the embryo transitions from relying on maternal energy reserves to independent energy production .

What expression systems are most effective for producing recombinant rainbow trout MT-ND4L?

For recombinant production of rainbow trout MT-ND4L, researchers should consider several expression systems with specific modifications to accommodate the hydrophobic nature of this protein:

  • Bacterial Expression Systems: E. coli-based systems with specialized strains designed for membrane proteins (e.g., C41(DE3) or C43(DE3)) can be effective when the gene is codon-optimized for bacterial expression. Including fusion partners like thioredoxin or SUMO can improve solubility.

  • Yeast Expression Systems: Pichia pastoris or Saccharomyces cerevisiae systems offer advantages for mitochondrial proteins as they provide a eukaryotic folding environment with appropriate post-translational modifications.

  • Insect Cell Systems: Baculovirus expression systems using Sf9 or High Five cells can effectively produce functional MT-ND4L, especially when targeting the protein to mitochondria using appropriate signal sequences.

The optimal approach typically involves testing multiple systems in parallel, evaluating expression levels, proper folding, and functional activity through NADH dehydrogenase activity assays.

What purification strategies overcome the challenges of MT-ND4L's hydrophobic nature?

Purifying recombinant MT-ND4L presents significant challenges due to its hydrophobicity and membrane-embedded nature. Effective strategies include:

  • Detergent Solubilization: Sequential screening of detergents is recommended, starting with milder options like n-dodecyl-β-D-maltoside (DDM) or digitonin, progressing to stronger detergents if needed.

  • Affinity Purification: Incorporating polyhistidine (His6) or other affinity tags at the N-terminus rather than C-terminus often yields better results for MT-ND4L.

  • Size Exclusion Chromatography (SEC): Critical for separating properly folded protein from aggregates while maintaining the protein in appropriate detergent micelles.

  • Native Complex Formation: Co-expression with other Complex I subunits can improve stability and solubility of MT-ND4L.

A typical purification workflow might include membrane isolation, detergent solubilization, immobilized metal affinity chromatography, followed by SEC and ion exchange chromatography, with all buffers containing appropriate detergents and potentially phospholipids to maintain protein stability.

How can researchers effectively measure the enzymatic activity of recombinant rainbow trout MT-ND4L?

Measuring the enzymatic activity of recombinant MT-ND4L requires assessing its function within the context of Complex I. Recommended approaches include:

  • NADH Oxidation Assays: Spectrophotometric monitoring of NADH oxidation rate at 340 nm in the presence of artificial electron acceptors like ferricyanide or specific Complex I electron acceptors.

  • Ubiquinone Reduction Assays: Measuring the reduction of ubiquinone analogs (e.g., decylubiquinone) coupled to NADH oxidation.

  • Oxygen Consumption Measurements: Using Clark-type electrodes or plate-based respirometry systems to measure oxygen consumption when recombinant protein is incorporated into proteoliposomes or membrane fractions.

  • Electron Transfer Efficiency Analysis: Evaluating the proton pumping efficiency using pH-sensitive dyes or proton transport assays in reconstituted systems.

For meaningful results, researchers should compare activity of wild-type and mutant forms of MT-ND4L, and control for background activity using specific Complex I inhibitors like rotenone.

What approaches can be used to study MT-ND4L variants identified in different rainbow trout populations?

To study population-specific MT-ND4L variants in rainbow trout, researchers should employ a multi-faceted approach:

  • Genomic Analysis:

    • NGS sequencing of mitochondrial DNA from diverse rainbow trout populations

    • Phylogenetic analysis to establish evolutionary relationships

    • Population genetics statistics to identify selection pressures

  • Functional Characterization:

    • Site-directed mutagenesis to recreate variants in recombinant systems

    • Comparative enzyme kinetics of different variants

    • Thermal stability assays to assess structural impacts

    • Protein-protein interaction studies to evaluate assembly differences

  • Physiological Impact Assessment:

    • Respirometry studies in tissues from fish with different variants

    • Swimming performance tests correlated with specific variants

    • Thermal tolerance comparisons between populations with different variants

  • Conservation Analysis:

    • Evolutionary conservation scoring of variant positions

    • Structural modeling to predict functional impacts

    • Comparison with variants in other fish species

This combination of approaches allows researchers to connect sequence variation to functional and evolutionary consequences in different environmental contexts.

How can CRISPR-based mitochondrial genome editing be optimized for MT-ND4L modification in rainbow trout?

Mitochondrial genome editing in rainbow trout presents unique challenges requiring specialized approaches:

  • Delivery Method Optimization:

    • Microinjection into fertilized eggs at early cleavage stages

    • Specialized mitochondrial-targeting peptides fused to CRISPR components

    • Lipid-based transfection optimized for mitochondrial targeting

  • CRISPR System Selection:

    • DdCBE (DddA-derived cytosine base editors) systems show higher efficiency for mtDNA

    • TALE-based systems may offer better specificity for certain modifications

    • MitoTALENs with optimized rainbow trout codon usage

  • Verification Strategies:

    • Heteroplasmy quantification using NGS and digital droplet PCR

    • Single-cell mitochondrial analysis to track editing efficiency

    • Functional validation through complex I activity assays

  • Off-target Analysis:

    • Whole mitochondrial genome sequencing

    • Monitoring nuclear off-targets with specialized bioinformatic pipelines

The current success rate for mitochondrial editing remains lower than nuclear genome editing, with heteroplasmy management being a key challenge. Researchers should plan for extensive screening to identify successfully edited lines and multiple generations of breeding to enrich for desired mitochondrial genotypes.

What are the most effective approaches for studying MT-ND4L's role in rainbow trout adaptation to environmental stressors?

Understanding MT-ND4L's role in environmental adaptation requires integrating multiple research approaches:

  • Field-to-Laboratory Comparisons:

    • Sample MT-ND4L sequences from wild populations across environmental gradients

    • Correlate sequence variations with environmental parameters (temperature, dissolved oxygen, etc.)

    • Establish laboratory conditions that mimic natural stressors

  • Experimental Design for Functional Analysis:

    • Acute vs. chronic exposure experiments

    • Transgenerational studies to assess epigenetic effects

    • Multi-stressor designs to capture environmental complexity

  • Analytical Techniques:

    • Respirometry under varying conditions (temperature, pH, oxygen levels)

    • Blue native PAGE to assess Complex I assembly changes

    • Mitochondrial membrane potential measurements using fluorescent probes

    • ROS production quantification in different environments

  • Integration with Other Mitochondrial Functions:

    • Comprehensive analysis of all ETC complexes

    • Mitochondrial dynamics (fusion/fission) in response to stressors

    • Coordination with nuclear-encoded complex I subunits

This integrated approach allows researchers to connect molecular variations to organismal fitness under changing environmental conditions, providing insights into both basic biology and conservation-relevant adaptive capacity.

How can researchers overcome the technical challenges in expressing functional rainbow trout MT-ND4L?

Researchers face several technical challenges when expressing functional rainbow trout MT-ND4L:

Challenge 1: Protein Misfolding and Aggregation

  • Solution: Employ specialized chaperone co-expression systems specifically designed for membrane proteins. Cold-shock expression protocols (15-18°C) often improve folding. Consider expressing MT-ND4L with natural binding partners from Complex I.

Challenge 2: Codon Usage Optimization

  • Solution: Carefully optimize codon usage for the selected expression system while preserving critical folding elements. Avoid over-optimization that might accelerate translation beyond folding capability.

Challenge 3: Toxicity to Host Cells

  • Solution: Use tightly regulated induction systems (e.g., tet-inducible) to control expression levels. Employ specialized host strains designed for toxic membrane proteins.

Challenge 4: Post-translational Modifications

  • Solution: Select eukaryotic expression systems for studies requiring native PTMs. Consider engineering artificial PTM sites if using bacterial systems for structural studies.

Challenge 5: Functional Validation

  • Solution: Develop complementation assays in yeast or mammalian cell lines with MT-ND4L deletions or mutations. Utilize artificial membrane systems to reconstitute activity.

What are the best approaches to study interactions between MT-ND4L and other Complex I subunits in rainbow trout?

Studying protein-protein interactions involving MT-ND4L requires specialized techniques adapted for membrane proteins:

  • Crosslinking Mass Spectrometry (XL-MS):

    • Use membrane-permeable crosslinkers like DSS or EDC

    • Optimize crosslinking conditions for mitochondrial inner membrane environment

    • Employ specialized data analysis pipelines for membrane protein complexes

  • Co-Immunoprecipitation Adaptations:

    • Develop specific antibodies against rainbow trout MT-ND4L or use epitope tags

    • Optimize detergent conditions to maintain interactions while solubilizing the complex

    • Use gentle elution methods to preserve weak interactions

  • Proximity Labeling Approaches:

    • APEX2 or BioID fusions to MT-ND4L

    • In vivo biotinylation followed by streptavidin pulldown

    • MS/MS analysis of labeled proteins

  • Computational Prediction and Modeling:

    • Homology modeling based on cryo-EM structures of complex I

    • Molecular dynamics simulations in membrane environments

    • Coevolution analysis to predict interaction interfaces

  • Functional Complementation:

    • Assessing the ability of mutant variants to restore Complex I activity

    • Systematic analysis of compensatory mutations in interacting subunits

TechniqueAdvantagesLimitationsBest Application Scenario
XL-MSDirect evidence of physical proximityRequires specialized equipmentDetailed structural analysis
Co-IPCaptures physiological interactionsDetergent may disrupt interactionsVerifying specific interactions
Proximity LabelingWorks in native cellular environmentMay label non-specific proximal proteinsDiscovering novel interactions
Computational MethodsFast, no wet lab requiredRequires validationGenerating initial hypotheses
Functional ComplementationDirectly tests functional relevanceLabor intensiveConfirming critical interactions

How can MT-ND4L research contribute to understanding metabolic differences among rainbow trout strains used in aquaculture?

MT-ND4L research offers valuable insights into metabolic differences among rainbow trout strains with direct applications to aquaculture:

  • Strain-Specific Energy Efficiency:

    • Comparative analysis of MT-ND4L sequences across commercial strains

    • Correlation of sequence variations with feed conversion efficiency

    • Respirometry studies comparing mitochondrial function between fast and slow-growing strains

  • Methodological Approach:

    • Tissue-specific expression analysis using qPCR and RNA-seq

    • Blue native PAGE to compare Complex I assembly and stability

    • Enzyme activity assays under varying temperature and pH conditions

    • Measurement of ROS production as an indicator of mitochondrial efficiency

  • Practical Applications:

    • Development of genetic markers associated with metabolic efficiency

    • Strain selection criteria based on mitochondrial function

    • Environmental optimization recommendations based on strain-specific mitochondrial performance

  • Integration with Other Parameters:

    • Correlation of MT-ND4L variants with swimming performance

    • Assessment of thermal tolerance linked to mitochondrial function

    • Relationship between MT-ND4L variants and disease resistance

This research directly connects molecular variation to economically significant traits in aquaculture settings, potentially informing breeding programs and management practices.

What role does MT-ND4L play in rainbow trout egg quality and early development?

MT-ND4L has emerging significance in rainbow trout reproduction and development, with implications for aquaculture:

  • Expression Patterns:

    • MT-ND4L transcripts are maternally provided to eggs and show differential expression between high-quality and low-quality eggs

    • Transcript abundance varies considerably even among eggs of similar quality

    • The maternal transcriptome, including mitochondrial genes, significantly influences developmental competence

  • Functional Importance:

    • During early development, the embryo relies almost entirely on maternal mitochondria

    • MT-ND4L is critical for ATP production during cleavage stages before zygotic genome activation

    • Mitochondrial function influences developmental timing and survival through energy provision

  • Research Approaches:

    • Comparative transcriptomics between viable and non-viable eggs

    • Monitoring mitochondrial membrane potential during early developmental stages

    • Tracking ATP production capacity during transition from maternal to embryonic control

  • Practical Applications:

    • Development of biomarkers for egg quality assessment

    • Potential targets for maternal diet modifications to improve mitochondrial loading

    • Selection criteria for broodstock based on mitochondrial performance

These findings connect mitochondrial function to key reproductive outcomes in rainbow trout, with significant implications for hatchery management practices and selective breeding programs.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.