Recombinant Oncorhynchus mykiss Shaker-related potassium channel tsha2

Shipped with Ice Packs
In Stock

Description

Definition and Molecular Overview

Recombinant Oncorhynchus mykiss Shaker-related potassium channel tsha2 (UniProt ID: Q9I829) is a voltage-gated potassium channel protein expressed heterologously in Escherichia coli. This full-length (1-483 amino acids) protein is fused with an N-terminal polyhistidine (His) tag for purification and detection purposes . It belongs to the Shaker family of potassium channels, which are critical for regulating membrane excitability in neurons and muscle cells by mediating potassium ion efflux during action potential repolarization .

Amino Acid Sequence

The protein sequence begins with MTVVSCEIQDETVVVSPLYQDD... (full sequence available in ). Key structural features include:

  • Voltage-sensing domain: Transmembrane helices (S1–S4) for detecting membrane potential changes.

  • Pore-forming domain (S5–S6): Facilitates potassium ion selectivity and conductance .

  • C-terminal regulatory domain: Modulates channel inactivation kinetics .

Expression and Purification

The protein is produced in E. coli as inclusion bodies, solubilized using denaturants, and refolded via gradual buffer exchange . Key steps include:

  1. Affinity chromatography: Ni²⁺-chelating resin for His-tag purification.

  2. Enterokinase cleavage: Removal of the Trx fusion partner.

  3. RP-HPLC: Final purification to >90% homogeneity .

Reconstitution Guidelines

  • Solubility: Reconstitute in deionized water (0.1–1.0 mg/mL).

  • Stability: Add 5–50% glycerol for long-term storage at -80°C .

Cardiac and Neurological Studies

  • Cardiac aging: Knockdown of Shaker homologs in Drosophila increases arrhythmia susceptibility and reduces lifespan, suggesting conserved roles in cardiac stress responses .

  • Mitochondrial homeostasis: Shaker channels regulate Ca²⁺ influx and ATP production, impacting cellular stress resilience .

Toxicology and Drug Development

  • Channel blockers: ShK toxin (from sea anemones) selectively inhibits Kv1.3 channels, a strategy explored for autoimmune disease therapies .

  • Trafficking assays: High-throughput screens (e.g., for KCNH2 variants) validate tsha2’s utility in studying channelopathies .

Comparative Analysis with Related Channels

FeatureO. mykiss tsha2 Drosophila Shaker Human Kv1.3
Expression SystemE. coliNative neurons/muscleHEK293 cells
Key FunctionAction potential repolarizationNeuronal excitabilityT-cell activation
Disease LinkNot yet characterizedCardiac aging, neurodegenerationAutoimmune disorders

Future Research Directions

  1. Functional characterization: Patch-clamp studies to define tsha2’s voltage dependence and pharmacological profile.

  2. Structural biology: Cryo-EM analysis to resolve pore architecture and ligand-binding sites.

  3. Disease modeling: Investigate tsha2’s role in piscine cardiac pathologies or environmental stress adaptations .

Product Specs

Form
Lyophilized powder
Please note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will fulfill your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributor for specific delivery details.
Please note: Our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are settled at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquotting the solution. Store at -20°C/-80°C. Our standard glycerol concentration is 50% and can be used as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer components, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot the protein for multiple uses to minimize freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
Shaker-related potassium channel tsha2; Trout shaker 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-483
Protein Length
full length protein
Species
Oncorhynchus mykiss (Rainbow trout) (Salmo gairdneri)
Target Protein Sequence
MTVVSCEIQDETVVVSPLYQDDCDEERGDQECSERVVINISGLRFETQLRTLSRFPTTLL GDPRKRMRFFDPLRNEYFFDRNRPSFDAILYYYQSGGKLRRPVNVTMDIFMEEMTFYEIE EEAIDMFKEDEGMIIEVERAMPDNEFQRQLWLLFEYPESSGPARMIAVVSVSVIVISIVI FCLETLPQFREDTSANLPLSNHHTTNGTTLHKKPNLFTDPFFMVETLCIVWFSFEFLVRF LSCPSKPAFFKNAMNSIDILAIAPYFITLGLELAEQQEAGSEQAMSLAILRVIRLVRVFR IFKLSRHSKGLQILGQTLHASISELGLLIFFLLIGVILFSSAVYFAEADDPESGFSSIPA AFWWAVVSMTTVGYGDMCPVTIGGKIVGSMCAIAGVLTIALPVPVIVSNFNYFYHRERND EETAVYTHVTCGQQNASFGEFKSTSDSRQSLTKSEDTEEDSCETIRLTHFNPFEHYTGKL TDV
Uniprot No.

Target Background

Function
This protein mediates the voltage-dependent potassium ion permeability of excitable membranes. It exists in open or closed conformations in response to the voltage difference across the membrane, forming a potassium-selective channel through which potassium ions can pass according to their electrochemical gradient.
Protein Families
Potassium channel family, A (Shaker) (TC 1.A.1.2) subfamily
Subcellular Location
Membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in oligodendrocytes and astrocytes.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.