Recombinant Oncorhynchus nerka NADH-ubiquinone oxidoreductase chain 3 (MT-ND3)

Shipped with Ice Packs
In Stock

Description

Molecular Identity and Classification

Recombinant Oncorhynchus nerka NADH-ubiquinone oxidoreductase chain 3 (MT-ND3) is a mitochondrially encoded protein that forms an essential component of Complex I in the respiratory chain. This protein is cataloged in chemical databases with a CBNumber of CB615631851, though it lacks a standardized CAS number assignment, reflecting its biological rather than synthetic chemical nature . The recombinant form represents the artificially expressed version of the naturally occurring MT-ND3 protein found in sockeye salmon mitochondria.

MT-ND3 belongs to the broader family of NADH dehydrogenase subunits that collectively form Complex I of the electron transport chain. This complex serves as the primary entry point for electrons in the mitochondrial respiratory system, accepting electrons from NADH and transferring them to ubiquinone via a sophisticated chain of iron-sulfur centers . Unlike many chemical compounds, this protein does not have a defined molecular weight in traditional terms, as its properties are determined by its amino acid sequence and post-translational modifications rather than simple chemical formulations.

Genetic Origin and Expression

The MT-ND3 protein is encoded by the mitochondrial genome rather than the nuclear genome. In Oncorhynchus species, as with other vertebrates, the mitochondrial DNA (mtDNA) is a circular genome containing genes for 13 proteins (including multiple subunits of NADH-ubiquinone oxidoreductase), 22 transfer RNAs, and 2 ribosomal RNAs . The MT-ND3 gene specifically codes for chain 3 of the NADH-ubiquinone oxidoreductase complex, a critical component of the inner mitochondrial membrane protein assembly responsible for electron transport.

Interestingly, the genetic organization of the MT-ND3 gene reveals particular features common among salmonid species. Unlike many protein-coding genes, the MT-ND3 gene does not terminate with a complete stop codon but instead ends with a single thymine nucleotide. The complete termination codon (TAA) is created through post-transcriptional polyadenylation, a feature shared with several other mitochondrial genes including COXII, ND4, and Cytochrome b . This post-transcriptional modification represents an efficient genetic strategy for compact mitochondrial genomes.

Protein Structure and Organization

The MT-ND3 protein functions as an integral component of the mitochondrial respiratory Complex I, one of the largest and most intricate protein assemblies in the mitochondrial inner membrane. Complex I comprises a central core of 14 highly conserved subunits capable of coupling electron transfer to proton translocation across the membrane . As one of these core components, MT-ND3 contributes to the membrane-embedded hydrophobic domain of the complex, participating directly in the proton-pumping mechanism that generates the electrochemical gradient necessary for ATP synthesis.

In the context of the complete mitochondrial respiratory apparatus, MT-ND3 occupies a precise position that reflects its evolutionary conservation. The protein's structure features multiple transmembrane segments that anchor it within the inner mitochondrial membrane, with specific regions exposed to both the matrix and intermembrane spaces. These structural characteristics enable MT-ND3 to participate in both electron transport and the conformational changes associated with proton pumping.

Functional Role in Energy Metabolism

The primary function of MT-ND3 within Complex I involves the critical process of coupling electron transfer from NADH to ubiquinone with proton translocation across the inner mitochondrial membrane. This energy-transducing function is fundamental to cellular respiration and ATP production in all aerobic organisms . The specific contribution of MT-ND3 to this process involves maintaining the structural integrity of the membrane domain of Complex I while participating in the conformational changes that drive proton movement.

Beyond its direct role in energy production, MT-ND3 also contributes to the regulatory mechanisms that control mitochondrial respiration in response to cellular energy demands. Mutations or dysfunction in MT-ND3 can lead to impaired energy production and increased generation of reactive oxygen species, potentially contributing to cellular stress and pathological conditions. This makes the study of recombinant MT-ND3 particularly valuable for understanding both normal physiological processes and potential disease mechanisms.

Recombinant Expression Systems

The production of recombinant Oncorhynchus nerka MT-ND3 involves sophisticated biotechnological approaches to express this mitochondrially encoded protein in suitable host systems. Unlike the native protein, which is translated within mitochondria using the mitochondrial genetic code, recombinant MT-ND3 must be expressed using nuclear expression systems with appropriate modifications to ensure correct folding and function.

Commercial sources for recombinant MT-ND3 include specialized biotechnology companies such as CUSABIO TECHNOLOGY LLC, which offers this protein for research applications . The table below summarizes the supplier information available from the search results:

SupplierContact InformationCountryProduct Advantage
CUSABIO TECHNOLOGY LLC027-87196173, cusabio@163.comChina58

Similar recombinant proteins from related salmon species, such as Oncorhynchus gorbuscha (pink salmon), are also commercially available, often with modifications such as His-tags to facilitate purification and detection . These recombinant proteins provide valuable tools for comparative studies across different salmonid species.

Research Applications and Significance

Recombinant Oncorhynchus nerka MT-ND3 serves multiple research purposes across various biological disciplines. In evolutionary biology, this protein provides insights into the conservation and divergence of mitochondrial functions across different fish species, particularly within the economically important Salmonidae family. Comparative analyses of MT-ND3 sequences from different Oncorhynchus species can reveal evolutionary relationships and adaptation mechanisms to different ecological niches.

In biochemical and biophysical research, recombinant MT-ND3 enables detailed structural and functional studies of Complex I components without the need for difficult purification from native tissues. This facilitates investigations into the molecular mechanisms of energy transduction, proton pumping, and electron transport within the respiratory chain. Additionally, the availability of recombinant MT-ND3 supports the development of antibodies and other research tools for studying mitochondrial function in various contexts.

Sequence Conservation and Divergence

The mitochondrial genomes of salmonid species show remarkable conservation in gene organization and sequence, reflecting their evolutionary relationships. Comparisons between Oncorhynchus nerka MT-ND3 and corresponding genes in related species such as Oncorhynchus tshawytscha (Chinook salmon), Oncorhynchus mykiss (rainbow trout), and Salmo salar (Atlantic salmon) reveal high degrees of sequence homology . This conservation underscores the critical functional importance of MT-ND3 in mitochondrial respiration across these species.

The table below presents a comparative analysis of sequence homology between MT-ND3 genes from different salmonid species, based on available mitochondrial genome sequences:

SpeciesNucleotide Homology (%)Amino Acid Homology (%)
O. nerka vs. O. tshawytscha~95-98~97-99
O. nerka vs. O. mykiss~93-96~95-98
O. nerka vs. S. salar~90-93~92-95
O. nerka vs. S. alpinus~88-92~90-94

These high levels of sequence conservation reflect the essential nature of MT-ND3 in mitochondrial function and the evolutionary constraints on this protein across the salmonid family. The slightly higher divergence at the nucleotide level compared to the amino acid level indicates the presence of synonymous mutations that maintain protein function while allowing genetic drift.

Emerging Applications in Mitochondrial Research

Recent advances in mitochondrial biology have expanded the potential applications of recombinant MT-ND3 in both basic and applied research. As a component of Complex I, MT-ND3 is implicated in the generation of reactive oxygen species (ROS), which play critical roles in cellular signaling, stress responses, and pathological conditions . Recombinant MT-ND3 thus provides a valuable tool for investigating these processes in controlled experimental settings.

Furthermore, comparative studies of MT-ND3 from different salmon species can offer insights into adaptations to diverse environmental conditions, including temperature variations, oxygen availability, and metabolic demands during migration. Such research has implications for understanding the evolutionary biology of salmonids as well as their responses to environmental changes, including climate-related stressors.

Biotechnological Potential and Challenges

The availability of recombinant Oncorhynchus nerka MT-ND3 opens possibilities for biotechnological applications beyond basic research. These include the development of biosensors for mitochondrial function, screening platforms for compounds affecting respiratory chain activity, and potential therapeutic approaches targeting mitochondrial dysfunction.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing the order, and we will accommodate your request.
Lead Time
Delivery time may vary based on the purchasing method and location. For specific delivery timelines, please consult your local distributors.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
MT-ND3; MTND3; NADH3; ND3; NADH-ubiquinone oxidoreductase chain 3; NADH dehydrogenase subunit 3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-116
Protein Length
full length protein
Species
Oncorhynchus nerka (Sockeye salmon) (Salmo nerka)
Target Names
Target Protein Sequence
MNLVTTIITITITLSAVLATISFWLPQISPDAEKLSPYECGFDPLGSARLPFSLRFFLIA ILFLLFDLEIALLLPLPWGDQLNAPTLTLLWSTAVLALLTLGLIYEWTQGGLEWAE
Uniprot No.

Target Background

Function
Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to be a component of the minimal assembly required for catalysis. Complex I facilitates the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is thought to be ubiquinone.
Protein Families
Complex I subunit 3 family
Subcellular Location
Mitochondrion membrane; Multi-pass membrane protein.

Q&A

What is MT-ND3 and what is its fundamental role in mitochondrial respiration?

MT-ND3 (Mitochondrially Encoded NADH:Ubiquinone Oxidoreductase Core Subunit 3) is a core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I). This protein plays an essential role in the electron transport chain by catalyzing electron transfer from NADH through the respiratory chain, using ubiquinone as an electron acceptor. It is encoded by mitochondrial DNA and is critical for the catalytic activity of Complex I . In Oncorhynchus nerka (sockeye salmon), as in other species, MT-ND3 contributes to cellular energy production through oxidative phosphorylation. The protein is highly conserved across species, reflecting its fundamental importance in cellular metabolism and energy production.

What experimental applications is recombinant Oncorhynchus nerka MT-ND3 suitable for?

Recombinant Oncorhynchus nerka MT-ND3 protein is particularly useful for:

  • Comparative biochemical studies: Analyzing the structural and functional similarities and differences between fish and mammalian respiratory complexes.

  • Evolutionary studies: Investigating the conservation of mitochondrial proteins across different vertebrate lineages.

  • Antibody production: Generating antibodies for detection of fish MT-ND3 in various research applications.

  • Structural biology research: Contributing to the understanding of Complex I architecture in different species.

  • Enzymatic activity assays: Examining NADH dehydrogenase activity under various experimental conditions .

The recombinant protein is typically supplied in lyophilized form and can be reconstituted to concentrations of 0.1-1.0 mg/mL for various applications, with addition of 5-50% glycerol recommended for long-term storage .

What is the optimal method for reconstituting and storing recombinant MT-ND3?

For optimal handling of recombinant Oncorhynchus nerka MT-ND3:

  • Reconstitution: Briefly centrifuge the vial before opening to bring contents to the bottom. Reconstitute the lyophilized protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.

  • Storage preparation: Add glycerol to a final concentration of 5-50% (typically 50% is recommended) and aliquot for long-term storage.

  • Temperature conditions: Store at -20°C/-80°C for long-term preservation, with working aliquots kept at 4°C for up to one week.

  • Stability considerations: Avoid repeated freeze-thaw cycles as they can compromise protein integrity and activity.

  • Buffer conditions: The protein is supplied in Tris/PBS-based buffer with 6% Trehalose at pH 8.0, which helps maintain stability .

These storage conditions are critical for maintaining protein integrity and functional activity for research applications.

How can MT-ND3 gene sequences be used for species identification in archaeological specimens?

MT-ND3 gene sequences can serve as effective markers for species identification in archaeological fish remains, particularly for Oncorhynchus species. The methodology involves:

  • DNA extraction protocol: Archaeological samples require specialized extraction methods to isolate often degraded mtDNA.

  • PCR amplification strategy: Target shorter segments (85-119 bp) of the MT-ND3 gene to increase success rates with degraded DNA.

  • Species-specific variation: The MT-ND3 gene contains regions with sufficient interspecies variability to distinguish between various Oncorhynchus species (O. nerka, O. tshawytscha, O. mykiss, etc.).

  • Sequence analysis: Direct sequencing of PCR products and comparison with reference sequences enables species identification.

  • Authentication protocols: Include negative controls and repeated analyses to verify results and exclude contamination .

Research has demonstrated that even with ancient samples, successful amplification and sequencing of MT-ND3 gene fragments can provide reliable species identification. For example, comparison of aligned sequences from the control region of salmonid mtDNAs showed that an ancient sample designated as ARC-10 could be tentatively identified as O. nerka based on sequence homology .

What are the known pathogenic mutations in MT-ND3 and their associated disease mechanisms?

Several pathogenic mutations in MT-ND3 have been identified and associated with specific disease mechanisms:

MutationDisease AssociationMechanismClinical Features
m.10191T>CLeigh Syndrome, EpilepsyDisrupts Complex I functionDevelopmental regression, seizures, LGS
m.10158T>CLeigh SyndromeAffects electron transportNeurological deterioration
Various mutationsLHON, Parkinson's DiseaseImpaired NADH dehydrogenase activityVision loss, movement disorders

Research has shown that MT-ND3 mutations, particularly m.10191T>C, are strongly associated with epilepsy in Leigh syndrome patients. In a study of seven patients with MT-ND3 mutations, six had the m.10191T>C mutation, and all six were diagnosed with epilepsy. Notably, three of these patients developed Lennox-Gastaut syndrome (LGS) .

What techniques are most effective for analyzing MT-ND3 function in mitochondrial complex I?

To effectively analyze MT-ND3 function within mitochondrial complex I, researchers employ several sophisticated techniques:

  • Site-directed mutagenesis: Create specific mutations in the MT-ND3 gene to understand structure-function relationships.

  • Blue Native PAGE: Separate intact respiratory chain complexes to assess the incorporation of MT-ND3 into Complex I.

  • Oxygen consumption measurements: Quantify the impact of MT-ND3 mutations on mitochondrial respiration.

  • NADH:ubiquinone oxidoreductase activity assays: Directly measure the enzymatic activity of Complex I.

  • Supercomplex analysis: Determine how MT-ND3 variants affect the formation of respiratory supercomplexes.

  • Molecular dynamics simulations: Model the structural consequences of mutations on protein dynamics and interactions.

  • Cryo-EM structural analysis: Visualize the position and interactions of MT-ND3 within the larger Complex I structure.

These approaches, often used in combination, provide comprehensive insights into how MT-ND3 contributes to Complex I assembly, stability, and catalytic function.

How can heteroplasmy levels of MT-ND3 mutations be accurately quantified?

Accurate quantification of heteroplasmy levels in MT-ND3 mutations requires precise methodological approaches:

  • Next-generation sequencing (NGS): Provides high-throughput, sensitive detection of heteroplasmic mutations.

    • Mapping sequenced reads to reference mitochondrial genome (NC_012920)

    • Using specialized alignment tools like Burrows-Wheeler Aligner

    • Employing variant calling algorithms optimized for mtDNA

  • Digital droplet PCR (ddPCR): Offers absolute quantification of mutant versus wild-type molecules.

    • Partitioning the sample into thousands of droplets

    • Amplifying DNA in each droplet independently

    • Counting positive and negative droplets to determine precise ratios

  • Pyrosequencing: Enables quantitative sequence analysis with good sensitivity for heteroplasmy.

    • Designing sequence-specific primers flanking the mutation site

    • Sequential addition of nucleotides with light signal generation

    • Mathematical analysis of signal intensities to determine percentages

  • Restriction fragment length polymorphism (RFLP): Used when mutations create or abolish restriction sites.

    • Digestion with appropriate restriction enzymes

    • Densitometric analysis of band intensities

In research settings, these methods can detect heteroplasmy levels as low as 1-5%, with NGS typically providing the highest sensitivity. The choice of method depends on the specific mutation, required sensitivity, and available resources .

What challenges exist in expressing and purifying recombinant MT-ND3 for structural studies?

Expression and purification of recombinant MT-ND3 presents several significant challenges:

  • Hydrophobicity: As a membrane protein, MT-ND3 contains multiple hydrophobic domains that can cause aggregation during expression and purification.

  • Toxicity to expression hosts: Overexpression of membrane proteins can disrupt host cell membranes, leading to toxicity and reduced yields.

  • Proper folding: Ensuring correct folding in heterologous expression systems is difficult, especially for mitochondrially-encoded proteins normally synthesized inside mitochondria.

  • Stability issues: The protein may be unstable when removed from its native complex environment.

  • Solubilization requirements: Appropriate detergents must be identified to extract and maintain the protein in solution without denaturing it.

Successful strategies include:

  • Expression in E. coli with fusion tags (e.g., His-tag) to improve solubility and facilitate purification

  • Use of specialized E. coli strains designed for membrane protein expression

  • Optimization of induction conditions (temperature, inducer concentration, duration)

  • Careful selection of detergents for membrane protein extraction

  • Addition of stabilizing agents like trehalose (6%) during purification and storage

How does MT-ND3 sequence diversity contribute to understanding salmonid evolution?

MT-ND3 sequence diversity provides valuable insights into salmonid evolution through several mechanisms:

  • Molecular clock analysis: MT-ND3 accumulates mutations at a relatively constant rate, allowing estimation of divergence times between Oncorhynchus species.

  • Phylogenetic relationships: Comparative analysis of MT-ND3 sequences helps resolve evolutionary relationships among Pacific salmon species.

  • Adaptive evolution signatures: Patterns of nonsynonymous vs. synonymous substitutions can reveal selective pressures on different lineages.

  • Population genetics: MT-ND3 variation within species can indicate historical population dynamics and founder events.

Research comparing aligned sequences of the control region adjacent to MT-ND3 in salmonid mtDNAs has demonstrated species-specific variation that allows discrimination between various Oncorhynchus species, including O. nerka, O. tshawytscha, O. mykiss, O. clarki, O. kisutch, O. keta, and O. gorbuscha . This diversity not only serves taxonomic purposes but also provides evidence of adaptive changes in mitochondrial function across different ecological niches occupied by these species.

What analytical approaches can differentiate between pathogenic MT-ND3 mutations and benign polymorphisms?

Distinguishing pathogenic MT-ND3 mutations from benign polymorphisms requires a multifaceted approach:

  • Conservation analysis: Evaluation of evolutionary conservation across species. Mutations affecting highly conserved residues are more likely to be pathogenic.

  • Functional prediction algorithms: Computational tools that assess the potential impact of amino acid substitutions on protein function.

  • Structural modeling: Analysis of how mutations might affect protein folding, stability, or interactions within Complex I.

  • Heteroplasmy threshold effects: Determination of whether the mutation load correlates with phenotype severity.

  • Biochemical assays: Direct measurement of NADH dehydrogenase activity in patient samples compared to controls.

  • Cybrid cell studies: Transfer of mitochondria from patient cells to mtDNA-depleted cells to isolate the effect of the mutation.

  • Animal models: Introduction of equivalent mutations in model organisms to observe phenotypic effects.

For example, the m.10191T>C mutation in MT-ND3 has been consistently associated with Leigh syndrome and epilepsy across multiple studies, with a high heteroplasmy threshold (median 82.5%) observed in affected patients . Such consistent clinical association, combined with functional evidence of respiratory chain dysfunction, strongly supports its pathogenicity.

What are the optimal conditions for PCR amplification of MT-ND3 from ancient DNA samples?

Amplification of MT-ND3 from ancient DNA samples requires specialized conditions to overcome the challenges of degraded DNA:

  • Primer design strategy:

    • Target short amplicons (85-119 bp) to increase success rates with fragmented DNA

    • Design multiple overlapping primer pairs targeting different regions

    • Use salmon-specific primers based on conserved regions

  • PCR reaction components:

    • Include 50μg/mL BSA to overcome PCR inhibitors commonly found in archaeological samples

    • Use 10× Taq DNA polymerase buffer (500mM KCl, 100mM Tris-HCl pH 8.8, 15mM MgCl₂, 1% Triton X-100)

    • Add 0.2mM each dNTP, 1.5 units Taq polymerase, and 1mM of each primer

  • Amplification conditions:

    • Initial denaturation: 93°C for 30 seconds

    • Annealing: 45-55°C for 60 seconds (optimize for specific primers)

    • Extension: 72°C for 90 seconds

    • Cycles: 30-45 (may require reamplification of initial products)

  • Authentication procedures:

    • Include multiple negative controls

    • Process samples in dedicated ancient DNA facilities

    • Replicate results from independent extractions

Using these optimized conditions, researchers have successfully amplified MT-ND3 fragments from archaeological salmon bone samples, allowing for species identification through sequence comparison with modern reference samples .

How can researchers effectively analyze the impact of MT-ND3 mutations on Complex I assembly and function?

Comprehensive analysis of MT-ND3 mutations' impact on Complex I requires a multi-method approach:

  • Blue Native PAGE and In-gel activity assays:

    • Separate intact respiratory complexes from mitochondrial preparations

    • Perform in-gel NADH dehydrogenase activity staining

    • Quantify both assembled Complex I levels and activity

  • Respirometry analysis:

    • Measure oxygen consumption rates in intact cells or isolated mitochondria

    • Assess Complex I-dependent respiration using specific substrates (glutamate/malate)

    • Compare maximal respiratory capacity after uncoupling

  • Protein-protein interaction studies:

    • Use co-immunoprecipitation to assess interactions between MT-ND3 and other Complex I subunits

    • Apply proximity labeling techniques to map the interactome around the mutated residue

  • Reactive oxygen species (ROS) measurements:

    • Quantify ROS production using fluorescent probes

    • Determine if mutations increase electron leakage from the complex

  • Mitochondrial membrane potential analysis:

    • Use potentiometric dyes to assess if mutations affect proton pumping efficiency

These complementary approaches provide a comprehensive understanding of how specific MT-ND3 mutations affect the assembly, stability, and catalytic function of Complex I, connecting molecular defects to cellular energy production impairment and disease pathogenesis.

What is the relationship between MT-ND3 mutations and neurological disorders?

MT-ND3 mutations have significant associations with several neurological disorders:

DisorderMT-ND3 MutationClinical FeaturesResearch Findings
Leigh Syndromem.10191T>C, m.10158T>CProgressive neurodegeneration, psychomotor regressionStrong association with epilepsy; 6/7 patients with m.10191T>C had seizures
Epilepsy/Lennox-Gastaut Syndromem.10191T>CMultiple seizure types, developmental delay3/6 patients with m.10191T>C developed LGS
Leber Hereditary Optic NeuropathyVarious MT-ND3 mutationsAcute or subacute vision lossDisruption of Complex I function
Parkinson's DiseaseMT-ND3 variantsMovement disorders, tremorImplicated in mitochondrial dysfunction

Research has demonstrated that MT-ND3 mutations can cause varying degrees of Complex I deficiency, impairing energy production in metabolically active tissues such as the brain. The m.10191T>C mutation in particular shows a strong association with epilepsy, with six out of seven patients in one study developing seizures. Moreover, three of these patients were diagnosed with Lennox-Gastaut syndrome, suggesting a specific genotype-phenotype correlation .

The pathogenic mechanism involves impaired NADH dehydrogenase activity, leading to bioenergetic failure, increased reactive oxygen species production, and ultimately neuronal dysfunction. The heteroplasmy level (percentage of mutant mtDNA) influences disease severity, although no linear correlation between mutant load and age of seizure onset was observed in clinical studies .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.