Recombinant Oncorhynchus tschawytscha NADH-ubiquinone oxidoreductase chain 3 (MT-ND3)

Shipped with Ice Packs
In Stock

Description

Biological Context and Function

NADH-ubiquinone oxidoreductase chain 3 (MT-ND3) is an essential component of mitochondrial Complex I (NADH:ubiquinone oxidoreductase), which serves as the first enzyme in the membrane-bound electron transport chain in aerobically respiring organisms . In Chinook salmon (Oncorhynchus tschawytscha), as in other vertebrates, this protein plays a crucial role in cellular respiration and energy production. The gene encoding this protein is located in the mitochondrial genome, reflecting its evolutionary importance in energy metabolism.

Evolutionary Conservation in Salmonids

MT-ND3 is highly conserved among salmonid species, with significant homology observed between Chinook salmon and other members of the Oncorhynchus genus. The close relatedness between Chinook salmon (O. tschawytscha) and Coho salmon (O. kisutch) is particularly evident in genomic analyses, where mapping rates for uniquely mapped reads show remarkable similarity, indicating conservation of essential mitochondrial proteins like MT-ND3 . This conservation underscores the protein's fundamental importance in salmonid physiology.

Protein Sequence and Predicted Structure

While the exact sequence of Chinook salmon MT-ND3 is not directly provided in the available research, valuable insights can be gained by examining the closely related Coho salmon (O. kisutch) MT-ND3. The Coho salmon protein consists of 116 amino acids with the sequence: "MNLITTIITITITLSAVLATVSFWLPQISPDAEKLSPYECGFDPLGSARLPFSLRFFLIAI LFLLFDLEIALLLPLPWGDQLNTPTLTLVWSTAVLALLTLGLIYEWTQGGLEWAE" . Given the close phylogenetic relationship between these species, the Chinook salmon MT-ND3 likely exhibits high sequence similarity.

Functional Domains and Membrane Association

MT-ND3, as a component of Complex I, is an integral membrane protein embedded within the inner mitochondrial membrane. Its hydrophobic amino acid composition facilitates this membrane association, with multiple transmembrane domains characteristic of proteins involved in the electron transport chain. These structural features are essential for the protein's role in proton translocation across the inner mitochondrial membrane, contributing to the establishment of the proton gradient necessary for ATP synthesis.

Function in Electron Transport and Energy Production

As a subunit of Complex I, MT-ND3 participates in the transfer of electrons from NADH to ubiquinone, coupled with the translocation of protons across the inner mitochondrial membrane. This process contributes to the electrochemical gradient that drives ATP synthesis, making MT-ND3 critical for cellular energy metabolism in Chinook salmon. The proper functioning of this protein is essential for efficient energy production in highly active tissues such as muscle.

Involvement in Reactive Oxygen Species Generation

Research on Complex I has demonstrated its significant role in the production of reactive oxygen species (ROS), which are considered a major cause of cellular oxidative stress linked to various pathological conditions . Complex I can reduce oxygen at two distinct sites: one associated with NADH oxidation in the mitochondrial matrix and another with ubiquinone reduction in the membrane . This ROS production is particularly relevant in understanding mitochondrial function and potential dysfunction in various tissues of Chinook salmon.

PropertyCharacteristicRelevance to Function
Oxygen Reduction SitesTwo sites: NADH oxidation site and ubiquinone reduction siteDetermines locations of ROS generation
Primary ROS MechanismReaction of O₂ with fully reduced flavin mononucleotideMechanism of superoxide formation
ROS Production OutcomeCombination of superoxide and H₂O₂Impacts cellular oxidative stress levels
Potential DependenceSet by NAD⁺/NADH ratioRegulates rate of ROS production

Expression Systems and Methodology

Recombinant production of MT-ND3 typically involves heterologous expression in bacterial systems, particularly Escherichia coli. Based on protocols used for similar proteins from related species, the full-length coding sequence of Chinook salmon MT-ND3 would be cloned into an appropriate expression vector, often incorporating an affinity tag such as a polyhistidine (His) tag to facilitate purification . The recombinant protein is then expressed under optimized conditions before extraction and purification procedures.

Potential Role in Phenotypic Variation

Chinook salmon exhibit a distinct color polymorphism resulting in two color morphs: white and red flesh-pigmented fish . This polymorphism represents an ideal model for studying biological variation in salmonids. While MT-ND3 has not been directly implicated in this color variation, as a component of the mitochondrial respiratory chain, it may influence metabolic processes that indirectly affect phenotypic expression, including pigmentation patterns through energy provision for carotenoid metabolism.

Tissue-Specific Expression and Function

Transcriptome analyses of different tissues in Chinook salmon have revealed tissue-specific gene expression patterns between red and white morphs, particularly in pyloric caeca, liver, and muscle . The pyloric caeca showed the most significant differences, with approximately 1125 differentially expressed genes, while liver and muscle exhibited fewer differences (43 and 31 differentially expressed genes, respectively) . As a mitochondrial protein essential for energy metabolism, MT-ND3 expression and function may vary across these tissues, potentially contributing to tissue-specific metabolic profiles.

Applications in Biochemical and Physiological Studies

Recombinant Chinook salmon MT-ND3 serves as a valuable tool for investigating mitochondrial function in salmonids. It enables detailed biochemical characterization of Complex I activity, including studies on electron transport efficiency, proton pumping capability, and ROS production under various conditions. Such research contributes to our understanding of energy metabolism in fish, particularly in the context of environmental adaptation and physiological stress responses.

Future Research Directions

Future research on recombinant Chinook salmon MT-ND3 should focus on:

  1. Determining the complete sequence and structural analysis of Chinook salmon MT-ND3

  2. Investigating potential associations between MT-ND3 variants and phenotypic traits

  3. Examining the protein's role in ROS production and oxidative stress responses

  4. Exploring the impact of environmental factors on MT-ND3 function and expression

  5. Developing targeted approaches to modulate Complex I activity for aquaculture applications

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on purchasing method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
If you require a specific tag type, please inform us for preferential development.
Synonyms
MT-ND3; MTND3; NADH3; ND3; NADH-ubiquinone oxidoreductase chain 3; NADH dehydrogenase subunit 3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-116
Protein Length
full length protein
Species
Oncorhynchus tshawytscha (Chinook salmon) (Salmo tshawytscha)
Target Names
Target Protein Sequence
MNLITTIITITITLSAVLATISFWLPQISPDAEKLSPYECGFDPLGSARLPFSLRFFLIA ILFLLFDLEIALLLPLPWGDQLDTPTLTLIWSTAVLALLTLGLIYEWTQGGLEWAE
Uniprot No.

Target Background

Function

This protein is a core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I). It's considered part of the minimal assembly necessary for enzymatic activity. Complex I facilitates electron transfer from NADH to the respiratory chain, with ubiquinone believed to be the immediate electron acceptor.

Protein Families
Complex I subunit 3 family
Subcellular Location
Mitochondrion membrane; Multi-pass membrane protein.

Q&A

What is MT-ND3 and what is its functional significance in the respiratory chain?

MT-ND3 (NADH-ubiquinone oxidoreductase chain 3) is a mitochondrially-encoded subunit of Complex I, which catalyzes the oxidation of NADH by ubiquinone while transferring four protons across the inner mitochondrial membrane. This process contributes approximately 40% to the total energy storage during electron transfer from NADH to molecular oxygen. MT-ND3 is specifically localized in the membrane domain of Complex I and contains a conserved loop region involved in the active/deactive state transition of the enzyme .

The functional significance of MT-ND3 lies in its role in regulating Complex I activity through conformational changes. The protein contains critical residues, particularly in the conserved loop region (including position G40 in salmonids), that control exposure of regulatory sites and influence the enzyme's catalytic efficiency. MT-ND3 contributes to the proton-pumping P-module of the membrane domain, which is essential for the vectorial proton transfer coupled with NADH oxidation .

How is the MT-ND3 gene conserved across Salmonidae species?

Evolutionary analysis of mitochondrial genes in the Salmonidae family has revealed significant patterns in MT-ND3 conservation. Studies comparing dN/dS ratios (the ratio of non-synonymous to synonymous substitution rates) between anadromous (marine/freshwater migratory) and freshwater-only salmon species have shown that MT-ND3 exhibits significantly larger dN/dS ratios in anadromous species . This suggests that MT-ND3 may be under different selective pressures in species that migrate between marine and freshwater environments compared to those that remain exclusively in freshwater.

The FEL (Fixed Effects Likelihood) analysis has identified both positively and negatively selected sites within the MT-ND3 gene across salmonid lineages. These conservation patterns reflect the functional constraints on the protein, with critical catalytic and structural regions showing higher conservation than regions that may be involved in adaptation to different environments .

What methods are recommended for recombinant expression of Chinook salmon MT-ND3?

Recombinant expression of Chinook salmon MT-ND3 presents several challenges due to its hydrophobic nature and mitochondrial origin. Based on successful approaches with other mitochondrial membrane proteins, recommended methods include:

  • Expression system selection: Bacterial systems (E. coli) with specialized strains designed for membrane protein expression, such as C41(DE3) or C43(DE3), are preferred for initial screening. For more complex folding requirements, insect cell systems (Sf9, High Five) using baculovirus vectors may yield better results for functional studies.

  • Vector optimization: Incorporation of fusion tags (e.g., His6, MBP, or SUMO) at the N-terminus can improve solubility and facilitate purification. Codon optimization for the expression host is essential, particularly considering that MT-ND3 is mitochondrially encoded and uses a different genetic code than nuclear genes.

  • Expression conditions: Reduced temperature (16-20°C), specialized media formulations, and the addition of specific lipids can significantly improve folding and stability of recombinant MT-ND3.

  • Detergent screening: A systematic approach to detergent screening is crucial, testing mild detergents like DDM, LMNG, or digitonin that preserve protein-protein interactions important for complex assembly.

When planning expression experiments, researchers should be aware that detergents like Triton X-100, commonly used in protein purification, can inhibit Complex I activity with an apparent Ki of 1 × 10−5 M, potentially affecting functional studies of recombinant MT-ND3 .

How can mitochondrial base editing technologies be applied to study MT-ND3 function in salmonids?

Recent advances in mitochondrial base editing technologies, particularly DddA-derived cytosine base editors (DdCBEs), provide powerful tools for studying MT-ND3 function through precise introduction of mutations. This approach has been successfully demonstrated in vivo using adeno-associated viral (AAV) delivery systems to install specific mutations like G40K in MT-ND3 .

For application to Chinook salmon MT-ND3 research, the methodology would involve:

  • Design of DdCBE pairs: Creating TALE domains specifically binding to the mtDNA regions flanking the target site in Chinook salmon MT-ND3. Different combinations of DddA-tox splits (G1333 or G1397) should be tested to achieve optimal on-target editing .

  • Delivery system optimization: For in vitro studies, transient transfection can be used with cultured salmon cells. For in vivo applications, AAV vectors adapted for fish models would be necessary, with appropriate tissue-specific promoters.

  • Editing confirmation and heteroplasmy assessment: Next-generation sequencing (NGS) is essential to quantify editing efficiency and heteroplasmy levels. In previous studies with other models, editing efficiencies of 17-49% have been achieved for MT-ND3 G40K installation .

  • Functional analysis: Assessing the impact of specific MT-ND3 mutations on Complex I activity through respirometry assays, ROS production measurements, and mitochondrial membrane potential assessments.

The G40K mutation in MT-ND3 is particularly interesting as it is located in the conserved loop involved in active/deactive state transition of Complex I. This mutation is predicted to lock Complex I in the active conformation, which could have significant implications for understanding energy metabolism in salmon under different environmental conditions .

What are the key interactions between MT-ND3 and other Complex I subunits in salmonids?

MT-ND3 occupies a critical position within Complex I, interacting with both peripheral and membrane domain subunits. Based on structural studies of Complex I from various species, the following key interactions can be inferred for salmonid MT-ND3:

  • Interface with Q-module: MT-ND3 interacts with subunits involved in ubiquinone binding, particularly those homologous to Nqo4 and Nqo6 in the bacterial enzyme. These interactions are crucial for coupling electron transfer to proton pumping .

  • Proton pumping pathway: As part of the P-module, MT-ND3 likely forms associations with subunits homologous to Nqo7, Nqo8, and Nqo10-14, several of which are related to bacterial Mrp cation/H+ antiporters that participate directly in vectorial proton transfer .

  • Conformational changes: The conserved loop of MT-ND3 undergoes significant conformational changes during the active/deactive transition of Complex I. This loop interacts with adjacent subunits to regulate enzyme activity under different physiological conditions.

Research approaches to study these interactions in Chinook salmon would include crosslinking studies, mutagenesis of interface residues, and potentially cryo-EM structural analysis of purified Complex I. Comparative analysis with known structures from mammals and bacteria would provide insights into salmon-specific adaptations in MT-ND3 interactions.

How do evolutionary pressures affect MT-ND3 sequence and function in anadromous versus freshwater salmonids?

The evolutionary trajectory of MT-ND3 in salmonids shows distinct patterns between anadromous (migratory between marine and freshwater environments) and freshwater-restricted species. Comprehensive analysis reveals:

  • Differential selective pressures: MT-ND3 exhibits significantly larger dN/dS ratios in anadromous species compared to freshwater species, indicating potentially adaptive evolution in migratory salmon populations . This suggests that the energy production requirements or oxidative stress conditions faced during migration may exert selective pressure on Complex I components.

  • Site-specific selection: Fixed Effects Likelihood (FEL) analysis has identified both positively and negatively selected sites in MT-ND3. The pattern of these sites differs between anadromous and freshwater lineages, potentially reflecting adaptation to different environmental demands .

GenedN/dS in Anadromous SpeciesdN/dS in Freshwater SpeciesStatistical Significance
MT-ND3HigherLowerp < 0.05
  • Functional implications: These evolutionary patterns suggest potential adaptations in MT-ND3 that might affect Complex I efficiency, ROS production, or regulatory mechanisms. The conserved loop containing position G40 is particularly interesting, as mutations in this region can affect the active/deactive transition of Complex I .

Methodologically, researchers studying these evolutionary patterns should employ phylogenetic comparative methods, ancestral sequence reconstruction, and functional characterization of recombinant proteins representing different evolutionary states to understand how changes in MT-ND3 sequence affect mitochondrial function in different salmon habitats.

What are the optimal approaches for site-directed mutagenesis studies of Chinook salmon MT-ND3?

Site-directed mutagenesis of MT-ND3 presents unique challenges due to its mitochondrial encoding. Researchers have several methodological options:

  • Mitochondrial base editing in vivo: DdCBE technology allows for precise C-to-T editing in mitochondrial DNA, enabling the introduction of specific mutations like G40K in MT-ND3 . This approach requires:

    • Design of paired TALE domains targeting the region flanking the mutation site

    • Optimization of DddA-tox splits for the specific target sequence

    • Delivery via appropriate vectors (plasmids for cell culture, AAV for in vivo studies)

    • Verification of editing efficiency via NGS

  • Recombinant expression with mutations: For in vitro studies, synthesizing the MT-ND3 gene with desired mutations and expressing it in heterologous systems. This approach allows for:

    • Multiple mutations to be tested in parallel

    • Functional studies of purified protein

    • Structure-function analysis of specific residues

  • Allotopic expression: Engineering nuclear-encoded versions of MT-ND3 with appropriate mitochondrial targeting sequences and codon optimization for nuclear expression. This can be combined with CRISPR-mediated knockout of endogenous MT-ND3 in cell lines.

The G40K mutation is of particular interest, as it affects the conserved loop involved in active/deactive transition of Complex I. Previous studies have shown that targeting the neighboring residue C39 (through S-nitrosation) protects against ischemia-reperfusion injury, suggesting that the G40K mutant could be explored in similar contexts .

What assays are most appropriate for measuring the functional impact of MT-ND3 mutations?

Several complementary approaches can assess the functional consequences of MT-ND3 mutations in Chinook salmon:

  • Complex I activity assays:

    • NADH:ubiquinone oxidoreductase activity using purified mitochondria or submitochondrial particles

    • Rotenone-sensitive NADH oxidation rate, as rotenone specifically inhibits Complex I with a Ki around 1 nM

    • Ferricyanide and HAR (hexaammineruthenium) reduction assays to assess electron transfer within Complex I

  • Mitochondrial respiration analysis:

    • High-resolution respirometry to measure oxygen consumption rates

    • Substrate-specific protocols to isolate Complex I contribution

    • Respiratory control ratio and P/O ratio determination

  • ROS production measurements:

    • Superoxide production using specific fluorescent probes

    • Hydrogen peroxide quantification

    • Assessment of ROS production under forward and reverse electron transport conditions

  • Active/deactive transition analysis:

    • Thermal deactivation kinetics at different temperatures

    • Assessment of the A/D equilibrium under varying conditions

    • SH-reagent sensitivity assays to probe conformational changes in the ND3 loop

For MT-ND3 mutations in the conserved loop region (like G40K), particular attention should be paid to changes in the active/deactive transition and sensitivity to ischemia-reperfusion conditions, as these phenomena are directly linked to conformational changes in this domain .

How can researchers effectively isolate and purify Complex I containing recombinant MT-ND3 from expression systems?

The isolation and purification of Complex I containing recombinant MT-ND3 requires careful consideration of membrane protein biochemistry and multiprotein complex assembly. A recommended workflow includes:

  • Mitochondrial isolation:

    • Differential centrifugation optimized for fish tissues or cultured cells

    • Percoll gradient purification for higher purity

    • Quality control via respiratory measurements and marker enzyme assays

  • Solubilization optimization:

    • Systematic screening of detergents (DDM, digitonin, LMNG)

    • Critical consideration of detergent concentration, as some common detergents like Triton X-100 can inhibit Complex I with a Ki of 1 × 10−5 M

    • Temperature, pH, and ionic strength optimization

  • Affinity purification strategies:

    • For recombinant MT-ND3 with affinity tags, appropriate resins (Ni-NTA, amylose)

    • For native Complex I, immunoaffinity approaches using antibodies against conserved subunits

    • Blue native electrophoresis for quality control of intact Complex I

  • Further purification and characterization:

    • Size exclusion chromatography to separate intact Complex I from subcomplexes

    • Activity measurements at each purification step to monitor functional integrity

    • Proteomic analysis to confirm subunit composition

Special consideration should be given to maintaining the active conformation of Complex I during purification, as the enzyme can transition to a deactive state under certain conditions, particularly involving the MT-ND3 loop region .

How can phylogenetic analysis inform our understanding of MT-ND3 evolution in Chinook salmon?

Phylogenetic analysis provides powerful insights into MT-ND3 evolution and adaptation in Chinook salmon within the broader context of salmonid evolution. Key methodological approaches include:

  • Sequence acquisition and alignment:

    • Comprehensive sampling of MT-ND3 sequences from diverse salmonid species

    • Multiple sequence alignment using algorithms optimized for highly conserved proteins

    • Manual curation of alignments to ensure proper codon alignment

  • Phylogenetic reconstruction:

    • Maximum likelihood and Bayesian inference methods

    • Appropriate nucleotide and amino acid substitution models

    • Partitioning strategies to account for codon position effects

  • Selection analysis:

    • Calculation of dN/dS ratios across the phylogeny

    • Identification of sites under positive selection using methods like FEL (Fixed Effects Likelihood)

    • Comparison of selection patterns between anadromous species like Chinook salmon and freshwater-restricted relatives

  • Ancestral sequence reconstruction:

    • Inference of ancestral MT-ND3 sequences at key nodes in salmonid evolution

    • Identification of critical amino acid substitutions along the Chinook salmon lineage

    • Correlation of sequence changes with ecological transitions

Previous research has shown that MT-ND3 exhibits significantly higher dN/dS ratios in anadromous salmonids compared to freshwater species, suggesting adaptive evolution potentially related to the energetic demands of migration . For Chinook salmon specifically, identifying the unique substitutions and selection patterns in MT-ND3 could provide insights into their specific adaptations to their anadromous lifestyle and particular ecological niche.

What statistical approaches are most appropriate for analyzing MT-ND3 mutational effects on Complex I function?

When analyzing the functional effects of MT-ND3 mutations, researchers should employ robust statistical approaches tailored to the specific experimental designs:

  • Enzyme kinetics analysis:

    • Michaelis-Menten kinetic parameters (Km, Vmax) comparison using non-linear regression

    • Analysis of inhibitor binding constants (Ki) for compounds like rotenone

    • Statistical comparison of parameters using t-tests or ANOVA with appropriate post-hoc tests

  • Dose-response relationships:

    • EC50/IC50 determination for activators/inhibitors

    • Hill coefficient calculation to assess cooperativity

    • Comparison of curves using extra sum-of-squares F test

  • Time-course experiments:

    • Repeated measures ANOVA for comparing activation/deactivation kinetics

    • Non-linear regression for fitting exponential or sigmoidal models to transition data

    • Survival analysis approaches for time-to-event data

  • Multi-parameter assays:

    • Principal component analysis to identify patterns in complex datasets

    • Multiple regression to identify relationships between variables

    • Mixed effects models to account for biological and technical variability

For studies involving the G40K mutation in MT-ND3, which affects the active/deactive transition of Complex I, statistical analyses should particularly focus on comparing kinetic parameters of the transition between wild-type and mutant enzymes . Power analysis should be conducted beforehand to ensure adequate sample sizes for detecting biologically meaningful effects.

How can structural data be integrated with functional assays to understand MT-ND3 mechanism?

Integrating structural and functional data provides the most comprehensive understanding of MT-ND3's role in Complex I. Recommended approaches include:

  • Homology modeling and structural prediction:

    • Generation of Chinook salmon MT-ND3 models based on known structures from related species

    • Refinement using molecular dynamics simulations

    • Validation through comparison with experimental data

  • Structure-function correlation:

    • Mapping of functionally important residues identified in mutagenesis studies onto structural models

    • Analysis of conservation patterns in the context of structural features

    • Identification of potential interaction networks involving MT-ND3

  • Molecular dynamics simulations:

    • Investigation of conformational changes in the MT-ND3 loop region

    • Assessment of how mutations like G40K affect protein dynamics

    • Simulation of the active/deactive transition process

  • Integration methods:

    • Correlation analysis between structural parameters and functional readouts

    • Development of predictive models relating structure to function

    • Visualization tools to represent multidimensional data

The conserved loop of MT-ND3 containing position G40 undergoes significant conformational changes during Complex I's active/deactive transition . By integrating structural models with functional data from assays measuring this transition, researchers can develop mechanistic hypotheses about how specific amino acids in MT-ND3 contribute to Complex I regulation in Chinook salmon.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.