Recombinant Oncorhynchus tschawytscha NADH-ubiquinone oxidoreductase chain 4L (MT-ND4L)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Oncorhynchus tschawytscha NADH-Ubiquinone Oxidoreductase Chain 4L (MT-ND4L)

Recombinant Oncorhynchus tschawytscha NADH-ubiquinone oxidoreductase chain 4L (MT-ND4L) is a mitochondrial protein subunit critical for Complex I of the electron transport chain. Native MT-ND4L is encoded by the mitochondrial genome and participates in transferring electrons from NADH to ubiquinone, a process essential for ATP synthesis . The recombinant version is engineered for research purposes, with applications in structural studies, biochemical assays, and disease modeling.

Functional Insights and Biochemical Roles

MT-ND4L is a core subunit of Complex I, facilitating electron transfer and proton pumping:

  • Electron Transfer: Binds NADH and transfers electrons to ubiquinone, generating a proton gradient .

  • Enzyme Classification: EC 1.6.5.3 (NADH:ubiquinone oxidoreductase) .

  • Complex I Assembly: Interacts with nuclear-encoded and mitochondrial-encoded subunits to form the functional enzyme .

Clinical and Research Relevance

While recombinant MT-ND4L is primarily a research tool, its study informs understanding of mitochondrial disorders:

  • Leber’s Hereditary Optic Neuropathy (LHON): Mutations in MT-ND4L (e.g., Val65Ala) disrupt Complex I function, impairing ATP production and vision .

  • Metabolic Disorders: Variants are linked to obesity and diabetes, though mechanisms remain under investigation .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please indicate your preferred format in the order notes, and we will prepare accordingly.
Lead Time
Delivery times may vary depending on the purchasing method and location. For precise delivery estimates, please consult your local distributors.
Note: Our proteins are shipped standard with blue ice packs. If dry ice shipping is required, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to collect the contents at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference point.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C, while lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
MT-ND4L; MTND4L; NADH4L; ND4L; NADH-ubiquinone oxidoreductase chain 4L; NADH dehydrogenase subunit 4L
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-98
Protein Length
full length protein
Species
Oncorhynchus tshawytscha (Chinook salmon) (Salmo tshawytscha)
Target Names
Target Protein Sequence
MTPVHFSFTSAFILGLMGLAFHRTHLLSALLCLEGMMLSLFIALSLWALQMEATGYSVAP MLLLAFSACEASAGLALLVATARTHGTDRLQSLNLLQC
Uniprot No.

Target Background

Function
This protein is the core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) and is believed to be part of the minimal assembly required for catalysis. Complex I functions in transferring electrons from NADH to the respiratory chain. Ubiquinone is thought to be the immediate electron acceptor for the enzyme.
Protein Families
Complex I subunit 4L family
Subcellular Location
Mitochondrion membrane; Multi-pass membrane protein.

Q&A

What is MT-ND4L and what is its normal function?

MT-ND4L (NADH-ubiquinone oxidoreductase chain 4L) is a protein encoded by the mitochondrial gene MT-ND4L. This protein functions as an integral component of Complex I in the mitochondrial electron transport chain. The primary role of MT-ND4L is to participate in oxidative phosphorylation, the process by which mitochondria convert energy from food into adenosine triphosphate (ATP), the cell's main energy source. Within the mitochondrial inner membrane, the protein contributes to the first step of electron transport, specifically helping transfer electrons from NADH to ubiquinone. This electron transfer creates an electrochemical gradient across the membrane that ultimately drives ATP production .

How is MT-ND4L involved in cellular energy production?

MT-ND4L contributes to cellular energy production as part of Complex I (NADH dehydrogenase), which is the first enzyme complex in the mitochondrial respiratory chain. This complex plays a critical role in transferring electrons from NADH to ubiquinone, establishing the beginning of the electron transport process. During oxidative phosphorylation, mitochondrial enzyme complexes including Complex I create an unequal electrical charge on either side of the inner mitochondrial membrane through the step-by-step transfer of electrons. The resulting electrochemical gradient provides the energy necessary for ATP synthase to produce ATP, the fundamental energy currency of the cell .

The efficiency of this energy production process can be affected by variations in the MT-ND4L gene sequence, which may alter protein function and subsequently impact cellular energy metabolism under different environmental conditions, such as high-altitude environments where oxygen availability is limited .

What genetic variations in MT-ND4L are associated with high-altitude adaptation?

Research has identified specific genetic variations in MT-ND4L that correlate with adaptation to high-altitude environments. A study examining MT-ND4L in Tibetan yaks, Tibetan cattle, and Holstein-Friesian cattle found that certain haplotypes show significant associations with high-altitude adaptability. Specifically, haplotype Ha1 in MT-ND4L demonstrated a positive association with high-altitude adaptation (p < 0.0017), while haplotype Ha3 showed a negative association with this adaptability .

These findings suggest that particular genetic variants of MT-ND4L may confer advantages in environments characterized by hypoxia, such as the Qinghai-Tibetan Plateau, where oxygen levels are reduced at elevations of 3000-5000 meters. The adaptation may involve optimizations in the mitochondrial respiratory chain's efficiency under low-oxygen conditions, allowing species like the Tibetan yak to thrive in environments that would cause hypertension and heart failure in non-adapted cattle breeds .

How do mutations in the MT-ND4L gene contribute to pathological conditions?

Mutations in the MT-ND4L gene have been implicated in several pathological conditions, most notably Leber hereditary optic neuropathy (LHON). A specific mutation identified in several families with LHON is the T10663C or Val65Ala mutation, which changes a single amino acid in the NADH dehydrogenase 4L protein, replacing valine with alanine at position 65 .

What experimental approaches are optimal for studying MT-ND4L function in different species?

When studying MT-ND4L function across species, researchers should consider a multi-faceted experimental approach:

Each approach offers complementary insights, and combining methods provides the most comprehensive understanding of MT-ND4L function across species .

What are the optimal conditions for handling recombinant MT-ND4L in laboratory settings?

When working with recombinant Oncorhynchus tschawytscha MT-ND4L, researchers should implement the following handling protocols to maintain protein integrity:

Storage conditions:

  • Store the protein at -20°C for routine use

  • For extended storage periods, maintain at -80°C to preserve stability

  • Prepare working aliquots and store at 4°C for up to one week to minimize freeze-thaw cycles

  • Avoid repeated freezing and thawing as this can compromise protein structure and function

Buffer considerations:

  • The protein is typically supplied in a Tris-based buffer containing 50% glycerol, optimized for stability

  • When designing experiments, consider the compatibility of this buffer with downstream applications

  • For applications requiring different buffer conditions, gradual dialysis is recommended to prevent protein denaturation

Purity assessment:

  • Verify protein purity (>90% for most commercial preparations) via SDS-PAGE before experimental use

  • Consider western blotting to confirm identity if antibodies against MT-ND4L are available

What experimental controls should be included when studying MT-ND4L function?

Robust experimental design for MT-ND4L functional studies should incorporate the following controls:

Positive controls:

  • Include known functional mitochondrial proteins from the same complex (other Complex I subunits)

  • For comparative studies, use well-characterized MT-ND4L from model organisms with established functional properties

Negative controls:

  • Utilize buffer-only conditions to establish baseline measurements

  • Include heat-denatured MT-ND4L to distinguish specific activity from non-specific effects

  • For genetic studies, include non-coding regions of mitochondrial DNA as controls

Validation controls:

  • Perform parallel assays with multiple methods to measure the same parameter

  • Include biological replicates from different preparations of the recombinant protein

  • For genetic association studies, verify findings across independent population samples

How can researchers assess the functional integrity of recombinant MT-ND4L?

Assessing the functional integrity of recombinant MT-ND4L involves multiple complementary approaches:

Spectrophotometric enzyme assays:

  • Measure NADH oxidation rates (λ = 340 nm) in the presence of ubiquinone analogues

  • Determine sensitivity to specific Complex I inhibitors (e.g., rotenone)

  • Calculate enzymatic parameters including Km and Vmax to compare with native protein

Structural verification:

  • Analyze secondary structure using circular dichroism spectroscopy

  • Assess membrane integration capacity using liposome incorporation assays

  • Verify proper folding through limited proteolysis experiments

Functional reconstitution:

  • Incorporate recombinant MT-ND4L into proteoliposomes with other Complex I components

  • Measure electron transfer capability in the reconstituted system

  • Compare activity with native Complex I isolated from mitochondria

How can recombinant MT-ND4L be used to study evolutionary adaptations to extreme environments?

Recombinant MT-ND4L serves as an excellent model for investigating evolutionary adaptations to extreme environments through several research approaches:

Comparative functional studies:

  • Express MT-ND4L variants from species adapted to different environments (e.g., high-altitude yaks vs. lowland cattle)

  • Assess functional differences in electron transport efficiency under varying oxygen concentrations

  • Measure relative ATP production rates to quantify adaptative advantages

Site-directed mutagenesis experiments:

  • Introduce specific mutations identified in high-altitude-adapted species into lowland species' MT-ND4L

  • Create chimeric proteins combining domains from different species to identify regions responsible for adaptation

  • Quantify the functional impact of individual SNPs identified in population studies

Structure-function relationship analysis:

  • Compare protein stability under stress conditions (temperature, pH, oxygen limitation)

  • Assess interaction strengths with other Complex I components across species variants

  • Determine whether adaptive mutations affect protein half-life or assembly into the complex

Research has already demonstrated that specific haplotypes in MT-ND4L (such as Ha1) show positive associations with high-altitude adaptability in Tibetan yaks and cattle, while others (Ha3) show negative associations. These findings suggest that mitochondrial gene variations play a crucial role in adaptation to hypoxic environments with p-values indicating statistical significance (p < 0.0017) .

What techniques are most effective for integrating recombinant MT-ND4L into functional mitochondrial studies?

When incorporating recombinant MT-ND4L into comprehensive mitochondrial function studies, researchers should consider these methodological approaches:

Submitochondrial particle reconstitution:

  • Deplete native MT-ND4L from submitochondrial particles using selective extraction techniques

  • Reconstitute with recombinant variants to assess functional rescue

  • Measure electron transfer rates before and after reconstitution to quantify incorporation efficiency

Cell-free expression systems:

  • Utilize mitochondrial translation systems to produce MT-ND4L in the presence of artificial membranes

  • Combine with other Complex I subunits to assess assembly and function

  • Apply this approach for high-throughput screening of multiple variants

Complementation in cellular models:

  • Develop cell lines with MT-ND4L deletions or mutations in mitochondrial DNA

  • Introduce recombinant protein through specialized delivery systems (e.g., lipid nanoparticles)

  • Assess restoration of mitochondrial function through multiple parameters (membrane potential, ATP production, ROS generation)

Integrated respirometry analysis:

  • Apply high-resolution respirometry to measure oxygen consumption in reconstituted systems

  • Assess the contribution of specific MT-ND4L variants to respiratory control ratios

  • Determine substrate preference patterns that may reflect evolutionary adaptations

These approaches allow researchers to bridge the gap between biochemical studies of isolated proteins and their functional significance in intact mitochondrial systems .

What are common challenges when working with recombinant MT-ND4L and how can they be addressed?

Researchers working with recombinant Oncorhynchus tschawytscha MT-ND4L frequently encounter several technical challenges that can be addressed with specialized approaches:

Protein solubility issues:

  • Challenge: As a hydrophobic membrane protein, MT-ND4L can aggregate during purification and handling

  • Solution: Maintain appropriate detergent concentrations throughout all procedures; consider using mild detergents like digitonin or n-dodecyl-β-D-maltoside (DDM) that preserve protein structure while maintaining solubility

  • Alternative approach: Express the protein with solubility-enhancing tags (e.g., MBP, SUMO) that can be cleaved after purification

Maintaining native conformation:

  • Challenge: Ensuring the recombinant protein adopts its native membrane-integrated conformation

  • Solution: Reconstitute the protein into liposomes or nanodiscs with lipid compositions mimicking the inner mitochondrial membrane

  • Validation method: Circular dichroism spectroscopy can confirm proper secondary structure formation

Functional assessment difficulties:

  • Challenge: Isolating MT-ND4L-specific activities from those of the entire Complex I

  • Solution: Design chimeric complexes where only MT-ND4L is substituted with the recombinant version

  • Control strategy: Compare activities with complexes reconstituted using well-characterized MT-ND4L variants

How should researchers interpret data from experiments using recombinant MT-ND4L compared to native protein?

When comparing results between recombinant and native MT-ND4L, several considerations help ensure proper data interpretation:

Activity differences table:

ParameterNative MT-ND4LRecombinant MT-ND4LInterpretation Approach
Electron transfer rateBaseline activityOften 70-90% of nativeCalculate relative activity rather than absolute values
Inhibitor sensitivityStandard response curveMay show altered IC50Compare inhibition patterns rather than absolute concentrations
Complex assemblyComplete integrationPartial assembly possibleAssess percentage of fully assembled complex
StabilityEnvironment-dependentMay show reduced half-lifeNormalize for protein degradation over time

Contextual considerations:

  • Recombinant proteins lack the co-translational assembly process that occurs naturally in mitochondria

  • Post-translational modifications present in native proteins may be absent in recombinant versions

  • The mitochondrial genetic code differs from the standard code, potentially affecting recombinant expression accuracy

Data normalization strategies:

  • Always include parallel assays with native preparations when possible

  • Develop correction factors based on established differences between native and recombinant proteins

  • Consider multiple functional parameters rather than relying on single measurements

What are the most promising future research directions involving MT-ND4L?

The study of recombinant Oncorhynchus tschawytscha MT-ND4L presents several promising research frontiers that merge basic science with potential applications:

Evolutionary biology applications:

  • Expanding comparative analyses across species adapted to various extreme environments

  • Developing comprehensive models of mitochondrial evolution under different selective pressures

  • Investigating convergent evolution of MT-ND4L in unrelated species facing similar environmental challenges

Biomedical research potential:

  • Using insights from natural MT-ND4L variants to understand mitochondrial disease mechanisms

  • Developing targeted approaches to address mitochondrial dysfunction in conditions like Leber hereditary optic neuropathy

  • Exploring potential therapeutic strategies based on adaptive MT-ND4L variants

Biotechnological innovations:

  • Engineering MT-ND4L variants with enhanced efficiency for bioenergetic applications

  • Developing biosensors based on MT-ND4L function for environmental monitoring

  • Creating cellular models with modified MT-ND4L to screen compounds affecting mitochondrial function

The continued investigation of this mitochondrial protein across different species and under various conditions will likely yield valuable insights into fundamental biological processes while potentially informing applications in medicine, biotechnology, and conservation biology .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.