Recombinant Onion yellows phytoplasma Antigenic membrane protein (amp)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Contact your local distributor for precise delivery estimates.
Note: Our default shipping includes standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, and can be used as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt; aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
Note: Tag type is determined during production. If a specific tag type is required, please inform us; we will prioritize its development.
Synonyms
amp; PAM_122; Antigenic membrane protein; Immunodominant membrane protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
33-233
Protein Length
Full Length of Mature Protein
Species
Onion yellows phytoplasma (strain OY-M)
Target Names
amp
Target Protein Sequence
DDKLDLNTLECKDALELTAADAADAEKVVKQWKVQNTSLNAKVTKDSVKVAVADNKVTVT PADGDAGKALSGSKILNLVGVCELNKLTLGTEKKLTLTVKDGKVDAEAGLKALKEAGAKV PATVNKDDVTFTVGKDDNANKVTVKAVDGKTTVSGQVVFEFTVAKTPWYKTVWFLTLVAV VVVAAVAGGVFFFVKKNKKNK
Uniprot No.

Target Background

Database Links

KEGG: poy:PAM_122

STRING: 262768.PAM_122

Subcellular Location
Cell membrane; Single-pass membrane protein.

Q&A

What is the antigenic membrane protein (Amp) in onion yellows phytoplasma?

The antigenic membrane protein (Amp) is an immunodominant membrane protein encoded by the onion yellows phytoplasma (OY). It plays a critical role in the pathogen's interaction with its host and is involved in its secretion system. Amp is characterized by a conserved protein motif that facilitates its export via the Sec translocation system, a mechanism also observed in other bacteria like Escherichia coli . The OY Amp gene consists of 702 nucleotides encoding a 233-amino acid protein, which has been successfully cloned and expressed in E. coli for further characterization .

How is the Amp protein detected in infected plants?

The Amp protein can be detected using polyclonal antibodies raised against recombinant Amp expressed in E. coli. Western blot analysis has demonstrated that these antibodies specifically react with extracts from OY-infected plants, making them a valuable tool for diagnosing phytoplasma infections . The specificity of detection lies in the conserved antigenic regions of the Amp protein.

What is the significance of the Sec translocation system in Amp secretion?

The Sec translocation system is pivotal for exporting Amp from the cytoplasm to other cellular compartments or extracellular spaces. In Escherichia coli, partial recombinant OY Amp has been localized to the periplasm, indicating successful processing and export through this system . This finding suggests that similar mechanisms operate in phytoplasmas, despite their inability to be cultured or transformed in vitro.

How does the Amp protein contribute to phytoplasma pathogenicity?

Amp proteins are thought to mediate interactions between phytoplasmas and their plant or insect hosts. For example, immunohistochemical analyses have shown that related proteins like ORF3 are preferentially expressed in insect hosts rather than plants, suggesting a role in host-specific adaptations . While direct evidence for Amp's role in pathogenicity remains limited, its immunodominant nature implies involvement in immune evasion or host-pathogen signaling.

What are the challenges in studying onion yellows phytoplasma proteins like Amp?

Phytoplasmas cannot be cultured or genetically transformed, which significantly limits experimental approaches. Researchers rely on heterologous expression systems (e.g., E. coli) to study individual proteins like Amp . Additionally, understanding protein secretion and localization requires indirect methods such as antibody-based detection and bioinformatics predictions.

How can recombinant Amp be utilized to study host-pathogen interactions?

Recombinant Amp expressed in E. coli provides a model for investigating host-pathogen interactions at the molecular level. For instance, antibodies raised against recombinant Amp can be used to track its localization within infected tissues, enabling studies on how this protein interacts with host cellular machinery . Moreover, comparative analyses with homologous proteins from other phytoplasmas could reveal conserved mechanisms of pathogenicity.

What experimental designs can elucidate the role of Amp in immune evasion?

To explore Amp's role in immune evasion, researchers could design experiments involving co-culture systems where plant cells are exposed to recombinant Amp or phytoplasma extracts. Observing changes in plant immune responses (e.g., expression of defense-related genes or production of reactive oxygen species) could provide insights into how this protein modulates host immunity.

Additionally, structural studies using techniques like X-ray crystallography or cryo-electron microscopy could identify potential interaction sites between Amp and host immune receptors.

How does genetic variability among phytoplasmas affect Amp function?

Genetic variability among different strains of onion yellows phytoplasma could influence the structure and function of their respective Amp proteins. Comparative genomics studies have shown that related proteins like ORF3 exhibit differences in promoter regions and expression patterns between insect-transmissible and non-transmissible strains . These variations may affect how effectively these proteins mediate host-pathogen interactions.

To investigate this further, researchers could sequence amp genes from multiple phytoplasma strains and assess their functional differences through heterologous expression and biochemical assays.

What are potential contradictions in data regarding Amp localization and processing?

One contradiction arises from observations that partially processed forms of recombinant OY Amp localize to the periplasm when expressed in E. coli, whereas its native processing within phytoplasmas remains poorly understood . This discrepancy highlights the need for caution when extrapolating findings from heterologous systems to native contexts.

Future studies could employ advanced proteomics techniques to analyze post-translational modifications of native Amp directly from infected plant tissues.

How can bioinformatics tools aid in predicting Amp's functional domains?

Bioinformatics tools such as SignalP can predict signal peptides and transmembrane regions within the Amp sequence, providing clues about its secretion pathway and potential interaction sites . For example, conserved motifs identified through multiple sequence alignments could indicate regions critical for function or immunogenicity.

Integrating these predictions with experimental data (e.g., mutagenesis studies) would enhance our understanding of how specific domains contribute to Amp's role in pathogenicity.

What techniques are used to clone and express recombinant Amp?

The amp gene is typically amplified using polymerase chain reaction (PCR) with primers designed based on its known sequence . The amplified product is then inserted into an expression vector compatible with E. coli systems. Expression is induced under controlled conditions, and recombinant protein is purified using affinity chromatography.

For example, partial OY Amp has been successfully expressed as a shorter processed form localized to the periplasm of E. coli, demonstrating its compatibility with bacterial secretion systems .

How are antibodies against recombinant Amp generated?

Polyclonal antibodies are raised by immunizing animals (e.g., rabbits) with purified recombinant Amp emulsified with an adjuvant to enhance immune response . The resulting sera are collected and tested for specificity using Western blot analysis against extracts from infected plants or heterologously expressed proteins.

These antibodies serve as powerful tools for detecting native Amp within infected tissues and studying its localization and processing.

What bioinformatics approaches are useful for studying amp gene evolution?

Phylogenetic analyses based on amp gene sequences can reveal evolutionary relationships among different phytoplasma strains. Tools like MEGA or Clustal Omega enable alignment of nucleotide or amino acid sequences to identify conserved regions or divergence points.

Such analyses could provide insights into how genetic variation influences functional properties of Amp across different hosts or ecological niches.

How can CRISPR-based methods be adapted for studying amp gene function?

Although direct genetic manipulation of phytoplasmas remains unfeasible due to their lack of culture systems, CRISPR-based approaches could be applied indirectly by targeting amp homologs expressed in surrogate systems like E. coli. For instance, CRISPR interference (CRISPRi) could suppress amp expression to study its effects on bacterial physiology or secretion pathways.

Alternatively, synthetic biology approaches could reconstruct minimal systems incorporating amp genes to simulate aspects of phytoplasma biology.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.