Recombinant Onion yellows phytoplasma Ribonuclease Y (rny)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on purchasing method and location. Contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which serves as a guideline.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type will be determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
rny; PAM_272; Ribonuclease Y; RNase Y
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-528
Protein Length
full length protein
Species
Onion yellows phytoplasma (strain OY-M)
Target Names
rny
Target Protein Sequence
MKGDYWRTHCIMDCSLLVFALICGSIIGYFLYSFFNQKKLEEKKQAFDDKLKEKEKDLQQ REQEMMRNAKIEITSLRQKLELDLEQRTNTIVDLESKNNRREELFNNRTESLNKREEHLD SEQQIISHTKKNLEQQIKEQETILNTQKQQLEKIASLTQDQARQIIMKETRDQTTYEMMS YIKQEEEKAKSEASKKAKTLLVLAMQKYAGDITGEKNISVVNIPNEDMKGRIIGRQGRNI KSLEVLTGVDLIIDESPCTIILSSFDPIRREIAKKTLEFLVSDGRIHPSRIEKALETSTI EVDNFIKEMGEEAAFITKIGEVHPDLIKILGKLHFRISYSQNVLKHSLEVAFLAGKLASE IGENEILARRAGLFHDIGKALDHEMEGSHVEIGVFIASKYKEKKEVIDAIASHHEDQEPQ SIIAVLVAIADTLSSARPGARKESVENYIQRLTKLETIANATEGVAKSYAIQAGREIRVI VEPDKIADNFIFQTARTIKEQIEKDISYNGVIKVTVIRETRAVEMAKL
Uniprot No.

Target Background

Function
Endoribonuclease initiating mRNA decay.
Database Links

KEGG: poy:PAM_272

STRING: 262768.PAM_272

Protein Families
RNase Y family
Subcellular Location
Cell membrane; Single-pass membrane protein.

Q&A

What is Ribonuclease Y in Onion yellows phytoplasma and what is its functional significance?

Ribonuclease Y (RNase Y) in Onion yellows phytoplasma (OY) is a membrane-associated endoribonuclease that plays a crucial role in RNA processing and turnover. The protein (UniProt ID: Q6YQV1) consists of 528 amino acids with a predicted N-terminal transmembrane domain followed by a KH RNA-binding domain and an HD catalytic domain .

RNase Y functions as a key regulator of global mRNA turnover and processing in phytoplasmas. Similar to RNase Y in other firmicutes like Bacillus subtilis, it likely targets UA-rich single-stranded regions, preferably on 5′ monophosphorylated substrates . This enzyme is particularly important for phytoplasmas as obligate intracellular parasites with reduced genomes, where RNA processing plays a critical role in gene expression regulation.

Functionally, RNase Y is thought to be important for:

  • Operon mRNA maturation

  • Processing of non-coding RNAs

  • Regulation of gene expression during host infection

  • Potential adaptation to different host environments (plant vs. insect vector)

What are the recommended storage and handling conditions for recombinant Onion yellows phytoplasma RNase Y?

Optimal handling of recombinant RNase Y requires specific conditions to maintain protein stability and activity:

Storage recommendations:

  • Store lyophilized powder at -20°C/-80°C upon receipt

  • For reconstituted protein, aliquot and store at -20°C/-80°C for long-term storage

  • Maintain working aliquots at 4°C for up to one week

  • Avoid repeated freeze-thaw cycles as they significantly reduce protein activity

Reconstitution protocol:

  • Briefly centrifuge the vial before opening to bring contents to the bottom

  • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% (default recommendation is 50%)

  • Aliquot for long-term storage

Buffer composition:

  • Commercial preparations typically use Tris/PBS-based buffer with 6% trehalose at pH 8.0 or Tris-based buffer with 50% glycerol

What expression systems are used for producing recombinant Onion yellows phytoplasma RNase Y?

Recombinant production of phytoplasma RNase Y typically employs bacterial expression systems, with E. coli being the most common host:

Recommended expression system:

  • Host: E. coli BL21(DE3) or similar strains

  • Vector: pET series with T7 promoter and N-terminal His-tag for purification

  • Induction: IPTG-inducible system with optimization for reduced inclusion body formation

Expression optimization strategies:

  • Lower induction temperature (16-20°C)

  • Reduced IPTG concentration (0.1-0.5 mM)

  • Co-expression with chaperones to improve folding

  • Use of specialized E. coli strains for membrane proteins

Purification approach:

  • Cell lysis using detergent-based buffers to solubilize membrane-associated protein

  • Immobilized metal affinity chromatography (IMAC) using the His-tag

  • Optional secondary purification via ion exchange or size exclusion chromatography

  • Buffer exchange to remove imidazole and concentrate protein

  • Lyophilization with stabilizing agents (like trehalose)

When expressing the full-length protein including the transmembrane domain, additional considerations for membrane protein extraction are necessary, including use of mild detergents or preparation of membrane fractions.

What methods can be used to assess RNase Y enzymatic activity in vitro?

Several techniques can effectively measure RNase Y activity:

Fluorescence-based assays:

  • Use fluorescently labeled RNA substrates with fluorophore-quencher pairs

  • Cleavage separates fluorophore from quencher, generating measurable signal

  • Allows real-time monitoring of activity

  • Can be adapted to high-throughput screening

Gel-based assays:

  • Incubate recombinant RNase Y with synthetic RNA substrates

  • Separate cleavage products using denaturing PAGE

  • Visualize with ethidium bromide, SYBR Green, or radiolabeling

  • Quantify band intensity to determine cleavage efficiency

MS-based approaches:

  • Use mass spectrometry to identify precise cleavage sites

  • MALDI-TOF for smaller oligonucleotides

  • LC-MS/MS for complex substrate mixtures

Activity optimization parameters to test:

  • pH range (typically 7.0-8.5)

  • Metal ion requirements (Mg²⁺, Mn²⁺)

  • Salt concentration effects

  • Temperature stability

  • Substrate concentration

When designing substrates, consider using sequences derived from known or predicted phytoplasma mRNA targets containing UA-rich regions that mimic natural substrates .

How can researchers effectively study RNase Y function in phytoplasma-infected plant systems?

Studying RNase Y in phytoplasma-infected plants presents unique challenges due to the unculturable nature of phytoplasmas:

Experimental approaches:

  • RNA degradome analysis:

    • Parallel analysis of RNA ends (PARE) to identify cleaved RNA molecules

    • Compare degradome profiles between healthy and infected plants

    • Identify cleavage sites with sequence signatures typical of RNase Y activity

  • In planta protein expression:

    • Express tagged versions of RNase Y in plants via agroinfiltration

    • Evaluate phenotypic effects and analyze changes in host RNA profiles

    • Perform pulldown experiments to identify interacting RNAs and proteins

  • RNase Y inhibition strategies:

    • Design antisense oligonucleotides targeting phytoplasma RNase Y mRNA

    • Express dominant-negative versions of RNase Y in plants

    • Evaluate effects on phytoplasma titer and symptom development

  • Transcriptome analysis:

    • Compare RNA-seq data from infected plants with different phytoplasma strains

    • Identify differentially processed transcripts that may be RNase Y targets

    • Focus on UA-rich regions showing evidence of endonucleolytic cleavage

  • Colocalization studies:

    • Use immunohistochemical methods with anti-RNase Y antibodies

    • Examine RNase Y localization in phloem tissue where phytoplasmas reside

    • Compare with other phytoplasma proteins to understand spatial organization

The endoplasmic reticulum (ER) is a key site affected during phytoplasma infection, with abnormal accumulation of ER-resident proteins and disrupted network structures . Considering potential interactions between RNase Y and the ER would be valuable in experimental design.

What is the potential role of RNase Y in phytoplasma-host interactions and pathogenesis?

RNase Y likely plays multiple crucial roles in phytoplasma pathogenesis and host-pathogen interactions:

Gene expression regulation:

  • Phytoplasma infection causes significant alterations in host gene expression, with 132 genes induced and 225 genes suppressed in infected cranberry plants

  • RNase Y may directly affect host mRNA stability or processing of phytoplasma transcripts encoding virulence factors

Metabolic adaptation:

  • Phytoplasmas increase expression of genes associated with nutrient metabolism while suppressing defensive pathways

  • RNase Y could regulate mRNAs encoding metabolic enzymes to optimize nutrient acquisition from host cells

ER homeostasis disruption:

  • Phytoplasma infection disturbs ER homeostasis, causing abnormal accumulation of ER-resident proteins and disrupted network structures

  • The membrane localization of RNase Y might facilitate interactions with host ER membranes

Vector-plant transition:

  • Similar to ORF3 protein which is preferentially expressed in phytoplasma-infected insects rather than plants , RNase Y might have differential activity in the two distinct host environments

  • This could help orchestrate the transition between plant and insect hosts

Host defense modulation:

  • The endoplasmic reticulum acts as a "battleground" between phytoplasmas and host plants

  • RNase Y could potentially degrade host defense-related transcripts or process phytoplasma RNAs to evade detection

Phytoplasma infection induces ER stress and unfolded protein response (UPR) activation in host plants, which appears to restrict phytoplasma proliferation . Understanding how RNase Y interacts with these host defense pathways would provide valuable insights into phytoplasma pathogenesis.

What is known about potential specificity factors for RNase Y in phytoplasmas?

While the Y-complex is well-documented as a specificity factor for RNase Y in B. subtilis , information on equivalent systems in phytoplasmas is limited:

Y-complex in B. subtilis:

  • Consists of three proteins: YaaT, YlbF, and YmcA

  • Influences RNase Y specificity toward operon mRNA maturation

  • Shows membrane localization dependent on RNase Y

  • Affects only a subset of RNase Y targets, suggesting a role as specificity factor

Potential phytoplasma equivalents:

  • Genomic analyses of phytoplasmas have not yet identified clear homologs of YaaT, YlbF, and YmcA

  • Given the reduced genomes of phytoplasmas, alternative specificity mechanisms may exist

  • Potential candidates would include membrane-associated proteins that interact with RNase Y

Research approaches to identify specificity factors:

  • Pull-down experiments using tagged RNase Y to identify interacting proteins

  • Yeast two-hybrid screening with RNase Y as bait

  • Comparative genomics between phytoplasma species with different host ranges

  • Proteomic analysis of membrane fractions from phytoplasma-infected plants

The Y-complex is conserved among Firmicutes, including the human pathogen Staphylococcus aureus , suggesting that similar specificity factors might exist in phytoplasmas, which also belong to the Firmicutes phylum despite their highly reduced genomes.

How does membrane localization affect RNase Y function in phytoplasmas?

Membrane localization appears crucial for proper RNase Y function, based on studies in B. subtilis that may provide insights for phytoplasma RNase Y:

Functional implications of membrane localization:

  • The first 25 amino acids of RNase Y form a transmembrane domain essential for membrane anchoring

  • Cytoplasmic forms of RNase Y (ΔTMD) show significantly reduced functionality

  • Membrane attachment likely limits access to certain RNA substrates while facilitating others

Effects observed in B. subtilis with cytoplasmic RNase Y:

  • Strains expressing only cytoplasmic RNase Y grow more than 2-fold slower than wild-type strains

  • Cell morphology is altered, with cells growing in chains rather than as single or dividing cells

  • Global gene expression is affected on a genome-wide scale

Spatial organization model:

  • Membrane localization may create microenvironments for RNA processing

  • In B. subtilis, RNase Y forms dynamic short-lived foci that move rapidly along the membrane

  • Upon transcription arrest, these foci become more abundant and increase in size

  • The Y-complex affects the size and number of RNase Y foci, potentially shifting the assembly toward more active smaller membrane complexes

For phytoplasmas, which reside in the nutrient-rich phloem sieve elements, membrane localization may also facilitate access to host-derived nutrients and substrates while providing protection from host defense mechanisms.

What approaches can be used to identify and validate RNase Y targets in phytoplasma-infected plants?

Identifying authentic RNase Y targets in the complex environment of infected plants requires integrated approaches:

High-throughput target identification:

  • RNA Degradome Analysis:

    • PARE (Parallel Analysis of RNA Ends) sequencing to identify cleaved RNA molecules

    • Focus on 5' monophosphorylated RNA ends characteristic of RNase Y cleavage

    • Compare degradome profiles between healthy plants and plants infected with different phytoplasma strains

  • CLIP-seq (Crosslinking Immunoprecipitation-sequencing):

    • Express epitope-tagged RNase Y in phytoplasmas if possible or in surrogate bacterial systems

    • Crosslink protein-RNA complexes and immunoprecipitate

    • Sequence bound RNAs to identify direct targets

  • Structure-informed bioinformatic prediction:

    • Screen transcriptome for UA-rich regions in single-stranded contexts

    • Focus on transcripts with differential abundance in infected vs. healthy plants

    • Prioritize candidates in metabolic and defense-related pathways

Validation methodologies:

  • In vitro cleavage assays:

    • Synthesize candidate RNA substrates

    • Incubate with purified recombinant RNase Y

    • Map cleavage sites using primer extension or RNA sequencing

  • Transcript stability assays:

    • Design reporter constructs containing predicted RNase Y target sequences

    • Express in plant protoplasts with or without RNase Y

    • Measure transcript half-life following transcription inhibition

  • Structure probing:

    • Use SHAPE (Selective 2'-Hydroxyl Acylation analyzed by Primer Extension) to determine RNA structure around putative cleavage sites

    • Confirm single-stranded nature of predicted target regions

When studying phytoplasma-infected plants, it's important to consider that:

  • Changes in transcript abundance may result from both direct RNase Y activity and indirect effects

  • Phytoplasmas may alter host RNA metabolism, complicating interpretation

  • Both phytoplasma and host transcripts could be RNase Y targets

What are the major challenges in studying RNase Y in phytoplasmas and how can they be addressed?

Phytoplasma research presents unique challenges that require innovative approaches:

Challenge 1: Unculturable nature of phytoplasmas

  • Impact: Cannot directly manipulate the organism using standard microbiological techniques

  • Solutions:

    • Use heterologous expression systems (E. coli, B. subtilis) for protein production and characterization

    • Establish plant and insect model systems that support phytoplasma infection

    • Develop cell-free transcription-translation systems supplemented with recombinant RNase Y

Challenge 2: Complexity of in planta studies

  • Impact: Difficult to distinguish direct effects of RNase Y from secondary plant responses

  • Solutions:

    • Use differential transcriptomics comparing multiple phytoplasma strains

    • Employ tissue-specific analyses focusing on phloem where phytoplasmas reside

    • Develop methods for targeted inhibition of RNase Y in planta

Challenge 3: Membrane-associated nature of RNase Y

  • Impact: Difficult to purify in active form with native conformation

  • Solutions:

    • Express constructs lacking the transmembrane domain for initial characterization

    • Use detergent screening to identify optimal solubilization conditions

    • Consider nanodiscs or liposome reconstitution systems to maintain membrane context

Challenge 4: Limited genetic tools for phytoplasmas

  • Impact: Cannot perform gene knockouts or directed mutagenesis

  • Solutions:

    • Use antisense oligonucleotides delivered through host phloem

    • Express dominant negative forms of RNase Y in plants

    • Explore CRISPR-Cas delivery systems adapted for unculturable bacteria

Challenge 5: Dual host lifecycle (plant and insect vector)

  • Impact: RNase Y may function differently in different host environments

  • Solutions:

    • Compare RNase Y expression and localization in both plant and insect hosts

    • Analyze RNA processing patterns in both environments

    • Investigate potential regulatory adaptations for host switching

How might inhibition of RNase Y activity be used to develop novel control strategies for phytoplasma diseases?

RNase Y represents a potential target for controlling phytoplasma diseases in economically important crops:

Rationale for targeting RNase Y:

  • Essential role in RNA metabolism suggests inhibition would severely impact phytoplasma viability

  • Membrane localization provides a potentially accessible target

  • Sufficient divergence from host RNases may allow selective targeting

Potential inhibition strategies:

  • Small molecule inhibitors:

    • Target the catalytic HD domain with metal-chelating compounds

    • Design molecules that interfere with membrane localization

    • Screen for compounds that disrupt protein-protein interactions important for RNase Y function

  • RNA-based approaches:

    • Design antisense oligonucleotides targeting rny mRNA

    • Develop RNA aptamers that bind to RNase Y protein and inhibit activity

    • Use RNA decoys mimicking natural substrates to competitively inhibit RNase Y

  • Protein-based inhibitors:

    • Express dominant-negative forms of RNase Y in plants

    • Develop peptides that interfere with RNase Y membrane localization

    • Target potential specificity factors required for proper RNase Y function

  • Host resistance enhancement:

    • Strengthen ER stress responses that appear to restrict phytoplasma proliferation

    • Manipulate UPR activation which negatively correlates with phytoplasma titer

    • Focus on upregulating BiP, as suppressing this ER-resident protein increases phytoplasma titer

Implementation considerations:

  • Delivery mechanisms must reach phloem tissue where phytoplasmas reside

  • Strategy should minimize impacts on beneficial microorganisms

  • Approach should ideally affect multiple phytoplasma species

  • Combined strategies targeting both phytoplasma and insect vectors may be most effective

What role might RNase Y play in the differential expression of virulence factors during transmission between plant and insect hosts?

Phytoplasmas must adapt to dramatically different environments when moving between plant and insect hosts:

Evidence for host-specific adaptation:

  • Some phytoplasma proteins like ORF3 are preferentially expressed in infected insects rather than plants

  • The non-insect-transmissible line of OY phytoplasma (OY-NIM) lacks orf3, suggesting its importance for insect interactions

  • Plasmid-encoded transmembrane proteins appear critical for insect transmission

Potential RNase Y functions in host adaptation:

ProcessIn PlantsIn Insect Vectors
Metabolic adaptationProcess transcripts for phloem sap utilizationAdjust metabolism for hemolymph nutrients
Defense evasionTarget plant immune response transcriptsProcess transcripts to avoid insect immunity
Transmission factorsSuppress transmission factors when in plantsUpregulate adhesins and transmission factors
Growth regulationMaintain appropriate multiplication rateBalance proliferation with vector fitness

Research strategies to investigate:

  • Compare RNase Y substrate profiles between phytoplasmas isolated from plants versus insect vectors

  • Analyze RNA processing patterns in both environments

  • Examine temporal dynamics of RNA processing during host switching

  • Compare RNase Y activity between insect-transmissible and non-transmissible phytoplasma strains

Understanding the role of RNase Y in host switching could provide fundamental insights into phytoplasma biology and potentially identify targets for interrupting transmission cycles.

Comparison of Host Plant Responses to Phytoplasma Infection Potentially Regulated by RNase Y

PathwayUpregulated GenesDownregulated GenesPotential RNase Y Role
DefenseCML (calcium signaling)PAL (phenylpropanoid)Processing of defense signaling transcripts
MetabolismFructokinase-6 (FK)Alanine, glycine, serine metabolismRegulation of nutrient acquisition
DevelopmentAP2 (floral development)Multiple developmental genesControl of witches' broom symptom development
PhotosynthesisLimited effectChlorophyll synthesis, photosystem componentsIndirect through metabolic changes
ER stressBiP and other UPR genesPotential direct target or sensor of infection

Data derived from transcriptome analysis of phytoplasma-infected cranberry plants and studies on ER stress responses .

Recommended Buffers for RNase Y Activity Assays

Buffer PurposeCompositionpHNotes
StorageTris/PBS with 6% trehalose or 50% glycerol8.0Prevents protein aggregation
Activity assay50 mM Tris-HCl, 5 mM MgCl₂, 60 mM KCl, 10 mM DTT7.5Basic activity buffer
Membrane protein extraction50 mM Tris-HCl, 150 mM NaCl, 1% Triton X-1007.5For native protein extraction
RNA substrate preparation40 mM HEPES, 100 mM NaCl, 4 mM MgCl₂7.5For maintaining RNA structure

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.