Recombinant Onychomys leucogaster NADH-ubiquinone oxidoreductase chain 3 (MT-ND3)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
MT-ND3; MTND3; NADH3; ND3; NADH-ubiquinone oxidoreductase chain 3; NADH dehydrogenase subunit 3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-115
Protein Length
full length protein
Species
Onychomys leucogaster (Northern grasshopper mouse)
Target Names
Target Protein Sequence
MNMLMVLTVNMMLSTCLILIAFWLPQLNLYTEKANPYECGFDPMSSARLPFSMKFFLVAI TFLLFDLEIALLLPLSWAIQMPNINIMTLTSFILVSVLALGLAYEWLQKGLEWTE
Uniprot No.

Target Background

Function
A core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I). It's considered part of the minimal assembly required for catalysis. Complex I facilitates electron transfer from NADH to the respiratory chain, with ubiquinone believed to be the immediate electron acceptor.
Protein Families
Complex I subunit 3 family
Subcellular Location
Mitochondrion membrane; Multi-pass membrane protein.

Q&A

What is MT-ND3 and what is its function in Onychomys leucogaster?

MT-ND3 (NADH-ubiquinone oxidoreductase chain 3) is a mitochondrially-encoded protein that functions as a critical component of Complex I in the respiratory chain of Northern grasshopper mice (Onychomys leucogaster). The protein is involved in the electron transport processes that generate ATP through oxidative phosphorylation. MT-ND3 catalyzes the transfer of electrons from NADH to ubiquinone (Coenzyme Q10), contributing to the establishment of a proton gradient across the inner mitochondrial membrane. This proton-motive force drives ATP synthesis via ATP synthase. The protein is encoded by the mitochondrial genome rather than the nuclear genome, which has significant implications for inheritance patterns and evolutionary studies .

How is recombinant MT-ND3 typically stored and what buffer conditions are optimal?

Recombinant Onychomys leucogaster MT-ND3 protein is optimally stored in Tris-based buffer with 50% glycerol. For long-term storage, the protein should be kept at -20°C or -80°C to maintain stability and prevent degradation. Working aliquots can be maintained at 4°C for up to one week, but repeated freeze-thaw cycles should be avoided as they can compromise protein integrity and function. The high glycerol concentration (50%) serves as a cryoprotectant, preventing ice crystal formation that could denature the protein. For experiments requiring different buffer conditions, researchers should perform gradual buffer exchange using dialysis or size exclusion columns to prevent protein precipitation or denaturation .

What phylogenetic significance does MT-ND3 have in studying Onychomys leucogaster populations?

MT-ND3, along with other mitochondrial genes, serves as a valuable phylogenetic marker for studying population structure and evolutionary history of Northern grasshopper mice. Research has revealed significant phylogeographic structuring of Onychomys leucogaster populations across western North America, particularly in three arid regions: Colorado Plateaus, Interior Plains, and Wyoming Basins. Analysis of mitochondrial DNA, including regions encoding MT-ND3, has detected 18 distinct mtDNA haplotypes with an average genetic divergence of 1.1%. Most notably, a clear phylogenetic split separates haplotypes restricted to the Wyoming Basins from all others, suggesting historical geographic isolation. These patterns indicate a complex history of population structuring and subsequent mixing throughout the late Pleistocene, providing insights into how these mice responded to Quaternary climatic oscillations in western North American arid regions .

How does the structure-function relationship of MT-ND3 contribute to respiratory chain efficiency in Onychomys leucogaster?

The structure-function relationship of MT-ND3 in Onychomys leucogaster is integral to respiratory chain efficiency, particularly in adaptation to the mouse's environmental conditions. The protein's transmembrane domains position it strategically within Complex I, allowing for optimal electron transfer. Research indicates that specific amino acid residues within MT-ND3 form critical interaction points with other subunits of Complex I, ensuring proper assembly and stability of the entire complex. The protein's structure contains conserved regions that directly participate in the proton pumping mechanism, while species-specific variations may reflect adaptations to different metabolic demands or environmental conditions .

Mutations or structural alterations in MT-ND3 can disrupt electron flow through Complex I, potentially reducing ATP production efficiency. In the context of Onychomys leucogaster, which inhabits arid environments with potentially fluctuating resource availability, efficient energy metabolism is particularly important. Comparative analyses of MT-ND3 sequences across populations from different ecological niches might reveal structural adaptations that optimize respiratory chain function under various environmental conditions. Such research could provide insights into the molecular basis of metabolic adaptation in these grasshopper mice .

What experimental approaches best capture the variation in MT-ND3 across different Onychomys leucogaster populations?

To effectively capture variation in MT-ND3 across different Onychomys leucogaster populations, a multi-faceted experimental approach is recommended. PCR amplification of the mitochondrial region containing MT-ND3, followed by restriction enzyme analysis and/or direct sequencing, has proven successful in detecting population-level variations. Previous research employed fifteen tetra- and heptanucleotide restriction enzymes to assay restriction-site variation in a 2150-bp PCR-amplified fragment of mtDNA representing the ND2 and part of the COI gene regions, which can be adapted for MT-ND3 studies .

For more comprehensive analysis, next-generation sequencing of the complete mitochondrial genome provides high-resolution data on MT-ND3 variation. This approach allows for detection of single nucleotide polymorphisms, insertions/deletions, and other structural variations that might not be captured by traditional methods. Additionally, integrating habitat data with genetic information enhances the interpretation of MT-ND3 variation. The ecological niche modeling approach used for Northern grasshopper mice in Montana demonstrates how environmental factors can be correlated with genetic variation . Such integrated approaches help researchers understand whether MT-ND3 variations correspond to adaptive responses to different environmental conditions or reflect historical population dynamics.

What are the implications of MT-ND3 genetic variations for understanding the evolutionary history and adaptation of Onychomys leucogaster?

The genetic variations in MT-ND3 provide crucial insights into both the evolutionary history and adaptive processes in Onychomys leucogaster. Mitochondrial DNA analysis, including MT-ND3, has revealed distinct phylogeographic structuring that corresponds to historical climate changes and geographical barriers. The clear phylogenetic split between Wyoming Basins populations and others suggests that historic isolation events have shaped the current genetic landscape of these mice .

These genetic variations may also reflect adaptive responses to different environmental conditions. The Northern grasshopper mouse inhabits diverse arid and semi-arid environments across western North America, each with unique ecological challenges. Variations in MT-ND3 might contribute to metabolic adaptations necessary for survival in these different habitats. For instance, mice in colder northern regions might have MT-ND3 variants that optimize energy production at lower temperatures, while those in more arid environments might have adaptations for metabolic efficiency under food and water limitations .

Comparative analysis of MT-ND3 with habitat modeling data indicates that genetic variations often correlate with specific ecological systems. Grasshopper mice show associations with several habitat types, including Big Sagebrush Steppe, Great Plains Mixedgrass Prairie, and Great Plains Riparian areas, suggesting that MT-ND3 variations might relate to specific adaptations to these diverse ecosystems .

How does the expression and function of MT-ND3 in Onychomys leucogaster compare with related species such as Baiomys taylori?

Comparative analysis of MT-ND3 between Onychomys leucogaster and related species like Baiomys taylori reveals both conserved functional domains and species-specific adaptations. Both proteins function as components of Complex I in the respiratory chain, but subtle structural differences reflect their evolutionary divergence and adaptation to different ecological niches. Onychomys leucogaster, as a predatory grasshopper mouse adapted to arid environments, may show specific adaptations in MT-ND3 that optimize energy metabolism under these challenging conditions .

Expression patterns of MT-ND3 may also differ between species, potentially reflecting different metabolic demands. Onychomys leucogaster's carnivorous diet and active predatory behavior might require different patterns of energy metabolism compared to the more granivorous Baiomys taylori. Research examining tissue-specific expression levels, particularly in metabolically active tissues like skeletal muscle, cardiac muscle, and brain, could reveal how MT-ND3 expression correlates with the distinct ecological and behavioral characteristics of these species .

What are the optimal protocols for expressing and purifying recombinant Onychomys leucogaster MT-ND3 for functional studies?

Expressing and purifying recombinant Onychomys leucogaster MT-ND3 for functional studies requires specialized protocols due to its hydrophobic nature as a transmembrane protein. The recommended expression system is a bacterial system using E. coli strains optimized for membrane protein expression, such as C41(DE3) or C43(DE3). The gene sequence should be codon-optimized for the expression host and cloned into a vector with an appropriate promoter and fusion tag (typically His-tag for ease of purification) .

For expression, the following protocol is recommended:

  • Transform expression plasmid into the selected E. coli strain

  • Grow cultures at 37°C until OD600 reaches 0.6-0.8

  • Induce protein expression with IPTG (0.1-0.5 mM) at reduced temperature (16-18°C)

  • Continue expression for 16-20 hours to maximize protein yield

  • Harvest cells by centrifugation and proceed to purification

For purification, a multi-step approach yields the best results:

  • Cell lysis using detergent-based buffers (e.g., n-dodecyl β-D-maltoside)

  • Immobilized metal affinity chromatography (IMAC) using Ni-NTA resin

  • Size exclusion chromatography for further purification

  • Quality assessment using SDS-PAGE and Western blotting

The purified protein should be stored in Tris-based buffer with 50% glycerol at -20°C or -80°C for long-term storage. The addition of mild detergents and specific lipids may be necessary to maintain the native conformation and activity of the protein during storage and subsequent functional studies .

What techniques are most effective for studying the phylogeographic patterns of MT-ND3 variations across Onychomys leucogaster populations?

For studying phylogeographic patterns of MT-ND3 variations across Onychomys leucogaster populations, a combination of molecular and computational approaches yields the most comprehensive results. Field sampling should be strategically designed to cover the species' range with particular focus on potential geographical barriers and different ecological zones. DNA extraction from tissue samples should use protocols optimized for high-quality mitochondrial DNA recovery .

The following technical approach is recommended:

  • PCR amplification of MT-ND3 and surrounding regions using conserved primers

  • Initial screening for variation using restriction enzyme analysis with tetra- and heptanucleotide restriction enzymes

  • Direct sequencing of the amplified regions for detailed analysis

  • Next-generation sequencing for comprehensive mtDNA analysis, when resources permit

For data analysis:

  • Sequence alignment using MUSCLE or similar algorithms

  • Haplotype identification and network construction

  • Phylogenetic tree construction using Maximum Likelihood or Bayesian methods

  • Population genetic analyses to assess genetic diversity, gene flow, and population structure

  • Integration with geographical information systems (GIS) data for spatial analysis

Previous research successfully identified 18 distinct mtDNA haplotypes with an average genetic divergence of 1.1% using similar approaches. The clear phylogenetic split between Wyoming Basins populations and others demonstrates the effectiveness of these methods in detecting meaningful population structure. Additionally, corroborating findings with nuclear markers can provide a more complete picture of population history and gene flow patterns .

How can researchers design experiments to investigate the functional impact of MT-ND3 variations on mitochondrial efficiency?

To investigate the functional impact of MT-ND3 variations on mitochondrial efficiency, researchers should implement a multi-tiered experimental approach that combines molecular biology, biochemistry, and physiological assessments. The experimental design should include both in vitro and, if possible, in vivo components to provide comprehensive insights .

Stage 1: Site-directed mutagenesis and expression systems

  • Generate recombinant MT-ND3 variants matching those identified in different Onychomys leucogaster populations

  • Express these variants in suitable systems (bacterial expression or mitochondria-deficient cell lines)

  • Purify the recombinant proteins for in vitro assays or confirm expression in cellular systems

Stage 2: Biochemical characterization

  • Measure electron transfer rates using spectrophotometric assays

  • Assess Complex I assembly and stability through blue native PAGE

  • Determine NADH:ubiquinone oxidoreductase activity using artificial electron acceptors

  • Analyze protein-protein interactions within Complex I using crosslinking or co-immunoprecipitation

Stage 3: Cellular energetics assessment

  • Measure oxygen consumption rates in cells expressing different MT-ND3 variants

  • Assess mitochondrial membrane potential using fluorescent probes

  • Quantify ATP production under various substrate conditions

  • Evaluate reactive oxygen species (ROS) production as a measure of electron leakage

Stage 4: Integration with ecological data

  • Correlate functional differences with the ecological niches of source populations

  • Assess whether variations confer advantages under specific environmental stressors (temperature, nutrient availability)

  • Develop models linking molecular function to organismal fitness in different environments

This comprehensive approach allows researchers to connect molecular variations in MT-ND3 to functional consequences at the biochemical, cellular, and potentially ecological levels .

What controls and validation steps are necessary when using recombinant MT-ND3 in experimental studies?

When using recombinant MT-ND3 in experimental studies, rigorous controls and validation steps are essential to ensure reliable and reproducible results. These measures address potential issues related to protein quality, experimental artifacts, and biological relevance .

Protein quality controls:

  • SDS-PAGE and Western blotting to confirm protein identity, purity, and molecular weight

  • Mass spectrometry for sequence verification and post-translational modification analysis

  • Circular dichroism spectroscopy to assess secondary structure and proper folding

  • Size exclusion chromatography to evaluate aggregation state and homogeneity

  • Batch-to-batch consistency testing for long-term studies

Functional validation:

  • Enzymatic activity assays to confirm that the recombinant protein retains native function

  • Comparison with native protein isolated from Onychomys leucogaster tissues when possible

  • Assessment of complex formation with other respiratory chain components

  • Spectroscopic analysis to confirm proper cofactor binding

Experimental controls:

  • Heat-inactivated protein as a negative control for activity-based assays

  • Wild-type protein as reference for studies of variants

  • Species-specific controls (e.g., MT-ND3 from related species) for comparative studies

  • Mock preparations (expression host without MT-ND3 gene) to control for contaminants

Biological relevance validation:

  • Correlation of in vitro findings with observations in mitochondrial isolates

  • Complementation studies in cell lines with MT-ND3 deficiencies

  • Comparison of results across different experimental systems to ensure consistency

  • Verification that experimental conditions (pH, temperature, ionic strength) reflect physiologically relevant parameters

How should researchers interpret conflicting data on MT-ND3 variations across different Onychomys leucogaster populations?

When faced with conflicting data on MT-ND3 variations across different Onychomys leucogaster populations, researchers should implement a systematic analytical framework. First, thoroughly evaluate methodological differences between studies that might account for discrepancies, including sampling strategies, DNA extraction methods, sequencing platforms, and analytical algorithms. Technical artifacts can sometimes be mistaken for biological variation, particularly in the detection of low-frequency variants .

Consider the different temporal and spatial scales of sampling across studies. MT-ND3 variations might reflect both historical evolutionary processes and recent ecological adaptations, operating at different time scales. The clear phylogenetic split observed between Wyoming Basins populations and others demonstrates how geographic barriers can influence genetic structure, but more recent gene flow might complicate these patterns .

Statistical reanalysis combining datasets (when methodologically compatible) can help resolve conflicts by increasing statistical power. Meta-analytical approaches allow researchers to identify consistent patterns while accounting for study-specific effects. Additionally, complementing mtDNA analysis with nuclear markers, which have different inheritance patterns and evolutionary rates, can help distinguish between competing hypotheses about population history .

Finally, integrate genetic data with ecological and phenotypic information to contextualize MT-ND3 variations. The habitat modeling data for Northern grasshopper mouse indicates specific ecological associations that might drive or maintain genetic differentiation. This ecological context can help researchers determine whether conflicting genetic patterns reflect adaptive processes or neutral evolutionary dynamics .

What statistical approaches are most appropriate for analyzing MT-ND3 sequence variation in the context of environmental adaptation?

For analyzing MT-ND3 sequence variation in the context of environmental adaptation, several sophisticated statistical approaches should be employed to establish robust correlations and potential causal relationships. To begin, researchers should utilize selection tests to identify signatures of adaptation, including dN/dS ratio analysis, McDonald-Kreitman tests, and Tajima's D statistic, which can detect departures from neutral evolution that might indicate selection pressures on MT-ND3 .

Environmental association analysis (EAA) provides a powerful framework for correlating genetic variation with specific environmental parameters. This approach can be implemented through redundancy analysis (RDA) or canonical correlation analysis (CCA), both of which can identify significant associations between MT-ND3 variants and environmental variables such as temperature, precipitation, or elevation. The habitat modeling data for Northern grasshopper mouse demonstrates the importance of variables like elevation, slope, and anthropogenic influence, which could be incorporated into such analyses .

To account for the confounding effects of population structure, which can create false associations, researchers should employ mixed models that include population history as random effects. Bayesian approaches that incorporate prior information about species' evolutionary history can further refine these analyses. Additionally, genome-wide association studies (GWAS) that include MT-ND3 alongside nuclear markers can help distinguish selection on MT-ND3 from background selection or demographic effects .

Finally, machine learning approaches such as random forests or gradient boosting can identify complex, non-linear relationships between MT-ND3 sequence variants and multiple environmental variables. These methods are particularly valuable when adaptive responses might involve interactions between multiple genetic and environmental factors, as is likely in complex traits like metabolic adaptation .

How can researchers effectively integrate MT-ND3 genetic data with habitat modeling to understand ecological adaptation?

Integrating MT-ND3 genetic data with habitat modeling requires a multidisciplinary approach that bridges molecular genetics and landscape ecology. This integration can reveal how mitochondrial genetic variation relates to environmental adaptation in Onychomys leucogaster. Researchers should begin by establishing spatial concordance between genetic clusters based on MT-ND3 variations and ecological niche boundaries defined by habitat models. Geographic information systems (GIS) provide the necessary tools for visualizing and quantifying these spatial relationships .

Next, researchers can employ ecological niche modeling (ENM) approaches, such as Maxent, to identify environmental variables most strongly associated with species distribution. The habitat suitability modeling for Northern grasshopper mouse identified elevation (21.9%), slope (10.3%), and anthropogenic influence (8.5%) as top contributors to model fit. These same variables can be tested for correlations with specific MT-ND3 haplotypes or variants using spatial regression techniques or redundancy analysis .

For more sophisticated analysis, researchers should implement landscape genetic approaches that explicitly model how landscape features influence gene flow and genetic differentiation. Resistance surface modeling can identify whether specific habitat types facilitate or impede gene flow of MT-ND3 variants. Circuit theory-based analyses can further reveal potential corridors and barriers that shape the current distribution of genetic variation .

To test specific hypotheses about adaptation, researchers can compare the performance of different models: those assuming neutral genetic differentiation versus those incorporating selection based on environmental variables. Bayesian model selection frameworks allow for formal comparison of these competing hypotheses. Additionally, mechanistic models that incorporate physiological parameters related to MT-ND3 function (such as metabolic rates under different temperature regimes) can provide insights into the functional basis of adaptation .

What are the best approaches for comparing experimental data on MT-ND3 function across different laboratory conditions and studies?

Comparing experimental data on MT-ND3 function across different laboratory conditions and studies requires robust meta-analytical approaches and standardization practices. Researchers should begin by developing a comprehensive data standardization framework that normalizes results relative to appropriate controls within each study. This might involve converting raw data to fold-changes or standardized effect sizes that can be meaningfully compared across different experimental platforms and conditions .

For direct comparison of functional parameters (such as electron transfer rates or oxygen consumption), conversion to common units and normalization to established standards are essential. When absolute standardization is not possible, researchers should focus on relative responses to perturbations (e.g., percent change in activity under stress conditions) rather than absolute values. Additionally, sensitivity analysis should be performed to determine how robust findings are to variations in experimental conditions .

To establish methodological best practices, researchers should organize collaborative efforts for ring trials, where multiple laboratories perform identical experiments following standardized protocols. Such approaches can identify laboratory-specific biases and establish reproducibility benchmarks. Finally, comprehensive reporting of experimental conditions in publications—including detailed buffer compositions, protein concentrations, temperature, pH, and equipment specifications—is essential for meaningful cross-study comparisons. When possible, the development and use of common reference materials and standard operating procedures can greatly enhance comparability across different research groups .

What emerging technologies could advance our understanding of MT-ND3 function and evolution in Onychomys leucogaster?

Several cutting-edge technologies are poised to revolutionize our understanding of MT-ND3 function and evolution in Onychomys leucogaster. CRISPR-Cas9 mitochondrial genome editing, though still challenging, is advancing rapidly and could enable precise manipulation of MT-ND3 sequences in living cells. This would allow direct testing of how specific variants affect mitochondrial function in controlled cellular environments. Complementary to this, single-cell proteomics and transcriptomics can reveal cell-type-specific effects of MT-ND3 variants, particularly important for understanding tissue-specific metabolic adaptations .

High-resolution cryo-electron microscopy (cryo-EM) now enables visualization of mitochondrial respiratory complexes at near-atomic resolution. Applied to Complex I containing different MT-ND3 variants, this technology could reveal how amino acid substitutions affect protein structure, subunit interactions, and electron transfer pathways. Similarly, hydrogen-deuterium exchange mass spectrometry (HDX-MS) can provide insights into protein dynamics and conformational changes that may not be apparent from static structural studies .

For evolutionary studies, long-read sequencing technologies enable the assembly of complete mitochondrial genomes from individual specimens with high accuracy. This facilitates comprehensive phylogenetic and population genetic analyses without the limitations of PCR-based approaches. Integration with ancient DNA techniques could extend these analyses to historical and extinct populations, providing a temporal dimension to our understanding of MT-ND3 evolution .

Finally, advanced computational approaches including molecular dynamics simulations and machine learning algorithms can predict how MT-ND3 variants affect protein function and interact with environmental variables. These in silico approaches, validated by experimental data, could accelerate our understanding of the molecular basis of adaptation in Onychomys leucogaster across its diverse habitats .

What interdisciplinary approaches could yield new insights into the ecological significance of MT-ND3 variations?

Interdisciplinary approaches that bridge molecular biology, ecology, physiology, and computational science offer tremendous potential for understanding the ecological significance of MT-ND3 variations. Eco-physiological studies that correlate MT-ND3 variants with whole-organism metabolic rates, thermoregulatory efficiency, and energy budgets could reveal how mitochondrial genetic variation influences fitness in different environments. Field metabolomics, measuring metabolite profiles of individuals with different MT-ND3 variants in their natural habitats, could provide direct evidence of metabolic adaptation .

Combining population genomics with detailed microhabitat characterization can reveal fine-scale associations between MT-ND3 variants and specific environmental features. The habitat modeling approach used for Northern grasshopper mouse demonstrates the importance of variables like elevation and vegetation type, which could be analyzed at much finer resolution to identify specific selective pressures .

Experimental evolution approaches, where populations with different MT-ND3 variants are subjected to controlled environmental stressors, could provide direct evidence of differential fitness. This could be complemented by translocation experiments in natural environments, tracking survival and reproductive success of mice with different MT-ND3 haplotypes .

Integration of paleoclimate reconstructions with phylogeographic analyses of MT-ND3 can reveal how past climate changes have shaped current genetic variation. This historical perspective is essential for distinguishing between recent adaptations and historical contingencies. The phylogenetic split observed between Wyoming Basins populations and others likely reflects such historical processes .

Finally, systems biology approaches that model how MT-ND3 variations affect entire metabolic networks could provide mechanistic insights into adaptation. These models, informed by transcriptomic, proteomic, and metabolomic data, can reveal how changes in a single mitochondrial gene propagate through biological systems to affect organismal fitness in different ecological contexts .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.