Recombinant O'nyong-nyong virus Structural polyprotein

Shipped with Ice Packs
In Stock

Description

Definition and Genomic Context

The Recombinant ONNV Structural Polyprotein refers to the protein complex encoded by the 3′ structural domain of the ONNV genome. It is translated from a subgenomic 26S mRNA and undergoes proteolytic cleavage to yield five structural proteins:

  • Capsid (C): Forms the nucleocapsid enclosing viral RNA .

  • E3/E2/E1 envelope glycoproteins: Mediate host cell attachment and membrane fusion .

  • 6K protein: Facilitates envelope protein processing and virion budding .

The structural polyprotein is distinct from the non-structural polyprotein (nsP1-4), which drives viral RNA replication .

Recombinant Systems

Reverse genetic systems for ONNV have been optimized using:

  • Fluorescent reporters: eGFP or mCherry fused to nsP3 to track replication .

  • Chimeric constructs: Substitution of CHIKV structural genes with ONNV counterparts to study vector specificity .

Table: Recombinant ONNV Models

ConstructApplicationKey OutcomeReference
ONNV-eGFPReal-time infection tracking63.5% infection rate in An. gambiae
CHIKV/ONNV E2 chimeraVector competence studiesReduced midgut escape efficiency
nsP3-mCherry fusionReplication complex visualizationIdentified plasma membrane spherules

Functional Insights

  • Capsid dynamics: The ONNV capsid binds viral RNA via conserved basic residues, with mutations at positions R76 and K104 abolishing nucleocapsid assembly .

  • Envelope glycosylation: N-linked glycosylation sites on E2 (N-142, N-262) are critical for mosquito midgut infection .

  • 6K role: Deletion of 6K reduces virion yield by 90% in mammalian cell lines (BHK-21, Huh7) .

Challenges and Future Directions

Current limitations include:

  • Low resolution structures: Cryo-EM of ONNV virions reveals a 70 nm icosahedral capsid, but E1-E2 spike details remain unresolved .

  • Host interactions: Structural polyprotein interactions with mosquito immune factors (e.g., Argonaute-2) are poorly characterized .

Ongoing work focuses on engineering temperature-sensitive mutations in the structural polyprotein to develop live-attenuated vaccines .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. If you require a specific format, please specify this in your order notes. We will fulfill requests whenever possible.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless otherwise requested. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which may serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and the inherent stability of the protein. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
Tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Structural polyprotein; p130
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
809-1247
Protein Length
Full Length of Mature Protein
Species
O'nyong-nyong virus (strain Igbo Ora) (ONNV) (Igbo Ora virus)
Target Protein Sequence
YEHATVIPNTVGVPYKTLVSRPGYSPMVLEMELQSVTLEPTLFLDYITCEYKTITPSPYV KCCGTAECKAKNLPDYNCKVFTGVYPFMWGGAYCFCDAENTQLSEAHVEKSESCKTEFAS AYRAHTASVSAKLRVFYQGNNITVSAYANGDHAVTVKDAKFVIGPLSSAWSPFDNKIVVY KGEVYNMDYPPFGAGRPGQFGDIQSRTPDSKDVYANTQLILQRPAAGAIHVPYSQAPSGF KYWLKEKGASLQHTAPFGCQIATNPVRAVNCAVGNIPVSIDIPDAAFTRVTDAPSVTDMS CEVASCTHSSDFGGAAVIKYTASKKGKCAVHSLTNAVTIREPNVDVEGTAQLQIAFSTAL ASAEFKVQICSTQVHCSATCHPPKDHIVNYPSPHTTLGVQDISTTAMSWVQKITGGVGLV VAIAALILIIVLCVSFSRH
Uniprot No.

Target Background

Function
The recombinant O'nyong-nyong virus structural polyprotein forms an icosahedral capsid (T=4 symmetry) composed of 240 copies of the capsid protein. This capsid is enveloped by a lipid membrane containing 80 spikes formed by E1-E2 heterodimer trimers. The capsid protein binds to the viral RNA genome near a ribosome binding site, facilitating translation post-genome release. It possesses autocatalytic protease activity, cleaving itself from the nascent structural protein. Following self-cleavage, it transiently interacts with ribosomes before binding viral RNA and rapidly assembling into icosahedral core particles. These nucleocapsids associate with the cytoplasmic domain of the spike glycoprotein E2 at the cell membrane, leading to budding and mature virion formation. During infection, virions attach to target cells, undergo clathrin-mediated endocytosis, and fuse with the host endosomal membrane, releasing the nucleocapsid into the cytoplasm. Uncoating, potentially triggered by ribosome interaction with capsid proteins, makes the genomic RNA accessible. The protein specifically inhibits interleukin-1 receptor-associated kinase 1 (IRAK1)-dependent signaling during viral entry, evading innate immune responses. The E3 protein provides a signal sequence for E3/E2 precursor translocation to the endoplasmic reticulum. Furin-cleaved E3 remains associated with E1, protecting it during transport. Following virion release, E3 is gradually released extracellularly. E2 mediates viral attachment by binding to the cell receptor, originating as a p62 precursor processed by furin before budding. The p62-E1 heterodimer is stable, unlike the unstable E2-E1 heterodimer that dissociates at low pH. Late p62 processing prevents premature E1 fusion activation. E2's C-terminus, initially transmembrane, undergoes palmitoylation-induced reorientation, enabling interaction with capsid proteins during budding. The 6K protein, a constitutive membrane protein, influences glycoprotein processing, cell permeabilization, and budding. It disrupts calcium homeostasis, likely at the endoplasmic reticulum, leading to cytoplasmic calcium elevation. Its lipophilic properties suggest a role in lipid selection for virion formation. Lastly, E1, a class II viral fusion protein, is inactive while bound to E2. Endosomal acidification induces E1/E2 dissociation and E1 trimerization, activating fusion and releasing the nucleocapsid. Efficient fusion requires cholesterol and sphingolipids in the target membrane, optimally at a cholesterol-to-phospholipid ratio of 1:2 and specificity for sterols with a 3-beta-hydroxyl group.
Subcellular Location
[Capsid protein]: Virion. Host cytoplasm. Host cell membrane. Host nucleus.; [Spike glycoprotein E2]: Virion membrane; Single-pass type I membrane protein. Host cell membrane; Single-pass type I membrane protein.; [6K protein]: Host cell membrane; Multi-pass membrane protein. Virion membrane; Multi-pass membrane protein.; [Spike glycoprotein E1]: Virion membrane; Single-pass type I membrane protein. Host cell membrane; Single-pass type I membrane protein.

Q&A

What is the genomic organization of ONNV structural polyprotein?

ONNV contains a single-stranded, capped, and poly-adenylated positive-sense RNA genome of approximately 11.8 kb. The genome contains two open reading frames (ORFs), with the second ORF coding for the structural polyprotein . This structural polyprotein is translated from subgenomic RNA and consists of the viral capsid protein (CP) and envelope proteins E3, E2, 6K, and E1 . Alternative translation through ribosomal frameshift can also produce a CP-E3-E2 TransFrame protein (TF) . The structural proteins are critical for viral particle assembly at the plasma membrane and determine important biological properties such as host range and virulence.

How does ONNV structural polyprotein compare with other alphaviruses?

ONNV shares close genetic similarity with CHIKV, with genome conservation of approximately 89% and sequence identity ranging between 77% and 85% . Despite this genetic proximity, ONNV exhibits unique vector specificity, being transmitted primarily by anopheline mosquitoes (particularly A. funestus and A. gambiae), while CHIKV is transmitted by aedine mosquitoes . Phylogenetic analyses demonstrate a close evolutionary relationship between ONNV and CHIKV compared to other human-relevant alphaviruses . This genetic similarity yet functional difference makes ONNV structural polyprotein particularly interesting for comparative studies among alphaviruses.

What are the functional domains of ONNV structural proteins?

The ONNV structural polyprotein is processed into individual proteins with distinct functions:

ProteinApproximate SizeFunction
Capsid (C)~30 kDaForms nucleocapsid, RNA binding, protease activity for self-cleavage
E3~11 kDaChaperone for E2 folding, facilitates E1-E2 heterodimer formation
E2~50 kDaReceptor binding, major determinant of host range, forms spikes with E1
6K/TF~6 kDaIon channel activity, facilitates budding
E1~50 kDaClass II fusion protein, mediates membrane fusion during entry

These domains work in concert during viral assembly and infection, with E1 and E2 forming heterodimers that are subsequently arranged as trimers on the viral surface .

What expression systems are optimal for producing recombinant ONNV structural proteins?

For successful expression of recombinant ONNV structural proteins, researchers should consider several expression systems:

The choice of expression system should be guided by the specific research questions and the particular structural protein(s) of interest.

How can chimeric viruses be designed to study ONNV structural protein functions?

Chimeric viruses between ONNV and CHIKV can be constructed using infectious clone technology to study the functions of specific structural proteins. The approach involves:

  • Clone Construction: Creating full-length infectious clones of ONNV (e.g., pONN.AP3 from strain SG650) and CHIKV (e.g., pCHIK.b from strain 37997) .

  • Region Substitution: Amplifying the structural protein region of interest (e.g., E2) from the donor virus using PCR with PFU turbo polymerase, introducing appropriate restriction sites as needed .

  • Restriction Digestion and Ligation: Digesting both the PCR product and recipient backbone with the same restriction enzymes, purifying the fragments, and ligating them to create chimeric constructs .

  • Transformation and Screening: Electroporating ligated constructs into competent cells, growing on selective media, and screening colonies for the desired insert using PCR and sequence verification .

This approach allows precise examination of how individual structural proteins contribute to viral phenotypes, including vector specificity, host range, and pathogenesis.

What purification strategies yield high-quality recombinant ONNV structural proteins?

Purification of recombinant ONNV structural proteins requires tailored approaches:

  • For Capsid Protein:

    • Affinity chromatography using His-tag or GST-tag fusion proteins

    • Ion exchange chromatography exploiting the basic nature of the capsid protein

    • Size exclusion chromatography for final polishing

  • For Envelope Glycoproteins (E1, E2):

    • Detergent solubilization from membrane fractions

    • Lectin affinity chromatography targeting glycan moieties

    • Immunoaffinity purification using specific antibodies

    • Size exclusion chromatography to separate monomers from aggregates

Maintaining protein stability throughout purification is critical—optimized buffer conditions (pH 7.4-8.0, 150-300 mM NaCl) and addition of glycerol (10-15%) or stabilizing agents may be necessary to prevent aggregation and preserve native conformation.

How can structural studies differentiate ONNV from CHIKV despite their genomic similarity?

Despite their high genetic similarity, ONNV and CHIKV structural proteins can be differentiated through multiple structural approaches:

  • X-ray Crystallography: High-resolution crystal structures can identify subtle differences in the three-dimensional arrangement of amino acids, particularly in the receptor-binding domains of E2 protein. Crystallization conditions must be optimized for each protein, typically requiring protein concentrations of 5-15 mg/mL and screening various precipitants, buffers, and additives.

  • Cryo-Electron Microscopy (Cryo-EM): Single-particle cryo-EM reconstruction of ONNV and CHIKV virions can reveal differences in the arrangement and conformation of E1-E2 heterodimers on the viral surface. This is particularly valuable for comparing native virion structures rather than individual recombinant proteins.

  • Hydrogen-Deuterium Exchange Mass Spectrometry (HDX-MS): This technique can map differences in protein dynamics and solvent accessibility between ONNV and CHIKV proteins, providing insights into functional differences not captured by static structural methods.

  • Epitope Mapping: Using a panel of monoclonal antibodies with peptide arrays or phage display technologies can identify unique antigenic regions that distinguish ONNV from CHIKV structural proteins, which is particularly valuable for diagnostic development.

These approaches can be complementary, with each providing different insights into structural determinants of ONNV's unique biological properties.

What molecular determinants in ONNV structural proteins influence vector specificity?

While non-structural proteins play a significant role in ONNV's unique vector specificity, the structural proteins also contribute to this phenotype. Researchers investigating this should consider:

  • E2 Receptor Binding Domain: The E2 protein contains regions that interact with host receptors and may influence tissue tropism in different mosquito species. Sequence analysis reveals unique residues in ONNV E2 compared to CHIKV that may affect vector specificity.

  • Glycosylation Patterns: Differences in N-linked and O-linked glycosylation sites between ONNV and CHIKV envelope proteins can affect interactions with vector tissues. Mutagenesis of predicted glycosylation sites followed by infectivity assays in different mosquito cells can elucidate their role.

  • pH-Dependent Conformational Changes: The fusion peptide in E1 undergoes conformational changes at specific pH thresholds that may differ between ONNV and CHIKV. These differences could affect fusion efficiency in endosomes of different vector species.

Experimental approaches to studying these determinants include site-directed mutagenesis of candidate residues followed by vector competence assays, binding studies with mosquito cell receptors, and pH-dependent fusion assays comparing wild-type and mutant viruses.

How can RT-LAMP assays be optimized for detecting recombinant ONNV structural polyprotein expression?

RT-LAMP (Reverse Transcription Loop-Mediated Isothermal Amplification) assays can be optimized for detecting ONNV structural polyprotein expression with the following parameters:

  • Primer Design: Six primers targeting conserved regions of the structural polyprotein gene should be designed using software like PrimerExplorer V5, with careful attention to the stability of primer ends (ΔG value ≤-4 kcal/mol is ideal) .

  • Reaction Conditions: Optimal conditions include:

    • MgSO₄ concentration: 4 mM provides the most intense ladder-type DNA bands

    • Reaction temperature: 64-68°C (optimal temperature should be determined experimentally)

    • Primer ratio: 1:8:2 (outer:inner:loop) provides good sensitivity

    • Addition of 0.5 M betaine to improve reaction efficiency

  • Detection Methods:

    • Gel electrophoresis to visualize ladder-type amplification products

    • Colorimetric detection using pH-sensitive dyes

    • Fluorescence monitoring with intercalating dyes

The optimized RT-LAMP assay provides a rapid, sensitive method (detecting as low as 10 pfu/reaction) for confirming successful expression of recombinant ONNV structural proteins in various systems .

How do mutations in ONNV structural proteins affect cross-reactivity with CHIKV antibodies?

Cross-reactivity between ONNV and CHIKV is a significant issue for both diagnosis and vaccine development. The structural proteins, particularly E1 and E2, contain both conserved and variable epitopes that influence antibody cross-reactivity:

  • Conserved Epitopes: Highly conserved regions, particularly in the E1 fusion protein, lead to broad cross-reactivity. Antibodies targeting these regions may neutralize both viruses but lack specificity for diagnostic purposes.

  • Variable Epitopes: Differences in exposed loops of E2 provide more virus-specific epitopes. Mutations in these regions can significantly alter antibody recognition patterns.

To experimentally characterize cross-reactivity:

  • Generate a panel of recombinant ONNV structural proteins with site-directed mutations in predicted epitope regions.

  • Test reactivity with CHIKV-specific monoclonal antibodies and polyclonal sera.

  • Measure binding affinities using ELISA, surface plasmon resonance, or bio-layer interferometry.

  • Assess neutralization potential of cross-reactive antibodies against both viruses.

What co-evolutionary patterns exist between ONNV structural proteins and Anopheles vector proteins?

The unique ability of ONNV to be transmitted by Anopheles mosquitoes suggests co-evolutionary adaptations between viral structural proteins and vector proteins. Researchers should investigate:

  • Receptor Interactions: Potential unique interactions between ONNV E2 protein and Anopheles-specific receptors that facilitate viral entry. Receptor identification can be approached through:

    • Co-immunoprecipitation of viral particles with mosquito cell membrane fractions

    • Yeast two-hybrid screening using E2 as bait against Anopheles cDNA libraries

    • CRISPR knockout screens in mosquito cell lines

  • Midgut Barriers: Adaptations in ONNV structural proteins that overcome midgut infection and escape barriers in Anopheles. Experimental approaches include:

    • Comparing infection rates of chimeric viruses in dissected mosquito midguts

    • Immunohistochemical analysis of viral antigen distribution in mosquito tissues

    • Transcriptomic analysis of midgut responses to ONNV versus CHIKV

  • Salivary Gland Interactions: Specific adaptations for salivary gland invasion and transmission. Methods include:

    • Ex vivo salivary gland infection assays

    • Analysis of viral stability in Anopheles saliva

Understanding these co-evolutionary patterns may explain how ONNV maintains its unique vector specificity despite genetic similarity to CHIKV and could inform strategies for transmission control.

How can researchers address stability issues in recombinant ONNV structural proteins?

Stability challenges are common when working with recombinant alphavirus structural proteins. For ONNV specifically:

  • Expression System Optimization:

    • Match the expression system to the protein target (bacterial for capsid, eukaryotic for envelope proteins)

    • Consider using fusion partners that enhance solubility (MBP, SUMO, thioredoxin)

    • Optimize codon usage for the expression host

  • Buffer Optimization:

    • Screen buffer conditions systematically (pH 6.5-8.5, salt concentration 50-500 mM)

    • Include stabilizing additives (glycerol 5-20%, non-ionic detergents, amino acids like arginine)

    • Consider protein-specific stabilizing agents based on their physicochemical properties

  • Storage Protocols:

    • Test stability at different temperatures (-80°C, -20°C, 4°C)

    • Evaluate freeze-thaw tolerance and consider single-use aliquots

    • Explore lyophilization for long-term storage

  • Structural Integrity Assessment:

    • Monitor protein folding using circular dichroism spectroscopy

    • Assess aggregation state through dynamic light scattering

    • Verify function through binding or activity assays specific to each protein

These strategies can significantly improve the yield and quality of recombinant ONNV structural proteins for downstream applications in structural biology, immunology, and drug development.

What strategies help overcome challenges in distinguishing ONNV from CHIKV in diagnostic assays?

Distinguishing between ONNV and CHIKV remains challenging due to their genetic and antigenic similarity. Researchers can implement these strategies to improve specificity:

  • Nucleic Acid-Based Approaches:

    • Target highly divergent regions of the structural polyprotein genes

    • Develop highly stringent RT-PCR conditions with carefully designed primers

    • Implement RT-LAMP assays with primers targeting ONNV-specific regions of the genome

    • Use next-generation sequencing for definitive differentiation

  • Serological Approaches:

    • Identify ONNV-specific epitopes in the structural proteins through epitope mapping

    • Develop competitive ELISA assays with virus-specific monoclonal antibodies

    • Implement differential virus neutralization tests with standardized protocols

  • Multiplex Strategies:

    • Develop assays that simultaneously detect multiple alphaviruses with species-specific readouts

    • Combine nucleic acid and serological testing for increased confidence

  • Validation Approaches:

    • Test assays against panels of characterized clinical isolates and reference strains

    • Include samples from co-endemic regions to assess cross-reactivity

    • Validate in field conditions relevant to ONNV-endemic regions

These approaches help address the challenge of potential misdiagnosis between ONNV and CHIKV, which has implications for understanding the true burden of each disease and their co-infections with malaria in endemic regions .

How might structural knowledge of ONNV inform next-generation vaccine development?

Understanding the structure-function relationships of ONNV structural polyprotein can guide rational vaccine design through multiple strategies:

  • Structure-Based Antigen Design:

    • Identify conserved, neutralizing epitopes across ONNV variants

    • Engineer stabilized forms of envelope proteins that present neutralizing epitopes more effectively

    • Design chimeric antigens that elicit broader protection against both ONNV and related alphaviruses

  • Novel Vaccine Platforms:

    • Develop virus-like particles (VLPs) displaying ONNV structural proteins in native conformation

    • Design mRNA vaccines encoding optimized ONNV structural polyprotein

    • Explore recombinant viral vectors expressing ONNV antigens

  • Cross-Protection Strategies:

    • Identify structural elements that could provide cross-protection against CHIKV

    • Design immunogens focused on conserved epitopes for broader alphavirus protection

    • Evaluate prime-boost strategies with different structural components

  • Attenuated Vaccine Approaches:

    • Introduce stabilizing mutations in structural proteins that maintain immunogenicity but reduce pathogenicity

    • Create chimeric viruses with altered structural proteins that induce protective immunity but have limited replication competence

As climate change increases the geographic range of potential vectors, developing effective vaccines against ONNV becomes increasingly important for global public health preparedness .

What research gaps remain in understanding ONNV structural polyprotein processing?

Despite advances in alphavirus research, several knowledge gaps remain regarding ONNV structural polyprotein processing:

  • Host Protease Interactions:

    • Identify specific host proteases involved in ONNV structural polyprotein processing

    • Determine if processing efficiency differs between human and mosquito hosts

    • Explore how polyprotein processing affects virus assembly in different cell types

  • Regulatory Mechanisms:

    • Characterize the factors controlling the efficiency of ribosomal frameshifting between 6K and TF proteins

    • Investigate potential regulatory roles of untranslated regions in structural protein expression

    • Determine how polyprotein processing rates affect virion assembly and maturation

  • Structural Intermediates:

    • Identify and characterize transient intermediates in the processing pathway

    • Develop methods to trap and study these intermediates using modified proteases or inhibitors

    • Determine the 3D structures of polyprotein precursors before complete processing

  • Comparative Processing:

    • Conduct systematic comparisons of processing efficiency between ONNV and CHIKV

    • Identify sequence determinants that affect processing kinetics and accuracy

    • Investigate how processing differences might contribute to vector specificity

Addressing these knowledge gaps would provide deeper insights into ONNV biology and potentially reveal new targets for therapeutic intervention.

How can researchers standardize ONNV structural protein production for multi-center studies?

Standardization is crucial for comparability across research groups working on ONNV structural proteins:

  • Reference Materials Development:

    • Establish a repository of validated plasmids encoding ONNV structural proteins

    • Develop standard operating procedures for protein expression and purification

    • Create calibrated reference protein samples for quality control

  • Protocol Harmonization:

    • Define minimal reporting standards for recombinant protein production

    • Standardize critical parameters (expression systems, purification methods, quality control metrics)

    • Implement round-robin testing between laboratories to ensure reproducibility

  • Quality Control Metrics:

    • Define acceptance criteria for purity (>95% by SDS-PAGE), identity (mass spectrometry confirmation), and functionality (binding assays)

    • Establish standard methods for assessing protein folding and antigenic integrity

    • Develop reference assays for batch-to-batch consistency

  • Data Management:

    • Create centralized databases for structural protein variant characterization

    • Implement standardized metadata collection for experimental conditions

    • Establish repositories for sharing raw data from structural studies

These standardization efforts will enhance reproducibility and accelerate progress in ONNV research by enabling more effective collaboration across laboratories with complementary expertise.

What interdisciplinary approaches might yield breakthroughs in understanding ONNV structural polyprotein?

Complex questions regarding ONNV structural polyprotein may be best addressed through interdisciplinary approaches:

  • Structural Biology and Computational Modeling:

    • Combine experimental structural data with molecular dynamics simulations

    • Use artificial intelligence approaches to predict structural features and interactions

    • Develop in silico models of virus-host protein interactions

  • Vector Biology and Virology:

    • Integrate mosquito tissue-specific transcriptomics with viral protein interaction studies

    • Develop advanced mosquito infection models that recapitulate natural transmission

    • Apply single-cell approaches to understand ONNV tropism in mosquito tissues

  • Immunology and Epidemiology:

    • Correlate structural features with population-level immune responses

    • Study how structural variations affect transmission dynamics in endemic regions

    • Develop improved serological tools based on structural insights

  • Systems Biology Approaches:

    • Map comprehensive interaction networks between viral structural proteins and host factors

    • Integrate multi-omics data to identify determinants of pathogenesis

    • Develop predictive models for structural protein evolution in response to selective pressures

Fostering collaborations across these disciplines could accelerate understanding of ONNV biology and contribute to broader knowledge about alphavirus-host interactions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.