Recombinant Opitutus terrae Protoheme IX farnesyltransferase (ctaB)

Shipped with Ice Packs
In Stock

Description

Definition and Functional Role

Recombinant Opitutus terrae ctaB (UniProt ID: B1ZMT0) is a truncated form of the native enzyme expressed in Escherichia coli. It belongs to the family of protoheme IX farnesyltransferases (EC 2.5.1.-), which are integral to synthesizing heme O—a precursor for heme A in cytochrome oxidases . This enzyme enables bacterial respiration by modifying heme B’s vinyl group to a hydroxyethyl farnesyl side chain .

Production and Characterization

Key specifications for the recombinant protein include:

PropertyDetail
Host OrganismEscherichia coli
Expression SystemRecombinant DNA technology with partial coding sequence
Purity>85% (SDS-PAGE confirmed)
Storage-20°C/-80°C (lyophilized form stable for 12 months; liquid form for 6 months)
ReconstitutionRequires deionized sterile water; glycerol (5–50%) recommended for stability
TagUndisclosed N- or C-terminal tag (determined during manufacturing)

The protein is available under product codes CSB-EP005824OEN1-B (Cusabio) and MBS7054437 (MyBioSource) , with lyophilized or liquid formulations.

Research Applications

Recombinant ctaB is primarily used in:

  1. Enzymatic Assays: Studying heme modification pathways in bacterial respiration.

  2. Antimicrobial Research: Targeting heme biosynthesis to disrupt pathogen viability (e.g., Staphylococcus aureus ctaB deletion attenuates virulence but increases antibiotic tolerance) .

  3. Structural Biology: Comparative studies with homologs to infer catalytic mechanisms .

Limitations and Future Directions

  • Partial Sequence: The recombinant protein lacks the full-length native structure, potentially affecting functional studies .

  • Species-Specific Variations: Functional insights from S. aureus ctaB (e.g., pigment overproduction in mutants) may not fully apply to Opitutus terrae.

  • Need for In Vivo Studies: Current data rely on in vitro assays; physiological roles in Opitutus terrae remain unexplored.

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, kindly indicate them in your order notes. We will strive to fulfill your request.
Lead Time
Delivery times may vary based on the purchasing method or location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please contact us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal use, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration ranging from 0.1 to 1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can serve as a reference for your preparations.
Shelf Life
The shelf life is influenced by various factors including storage conditions, buffer components, temperature, and the intrinsic stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
Tag type is determined during production. If you have a specific tag type preference, please communicate it to us, and we will prioritize development of the specified tag.
Synonyms
ctaB; Oter_2075; Protoheme IX farnesyltransferase; Heme B farnesyltransferase; Heme O synthase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-295
Protein Length
full length protein
Species
Opitutus terrae (strain DSM 11246 / JCM 15787 / PB90-1)
Target Names
ctaB
Target Protein Sequence
MSTTPASNAKFSDYLELTKPRLSMLSVMTALVGYLAARPPWDPIQLALLVLGTSAAAGGV AALNQWLEHDTDAHMKRTADRPIPAGKVATGSAFVLGVLMCIGSLFLLYALVHPLAALFT LLTIFSYLGWYTPAKRWSRWSTEIGAVAGAFPPLIGWSAGEGRVTALGWVLFGVLFFWQV PHFMAVAWTYRKDYSAVHFPMLPVRDESGERVALWSLINTAALLVTSLLPLLWGLTTWFY GVAAAVTGLWFLWQAIKFMQPATRDRAARKLFFASIGYLPLVLGALVIDRLFLVS
Uniprot No.

Target Background

Function
This enzyme catalyzes the conversion of heme B (protoheme IX) to heme O by substituting the vinyl group on carbon 2 of the heme B porphyrin ring with a hydroxyethyl farnesyl side group.
Database Links
Protein Families
UbiA prenyltransferase family, Protoheme IX farnesyltransferase subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Protoheme IX farnesyltransferase (ctaB) and what is its biochemical function?

Protoheme IX farnesyltransferase (ctaB) is a membrane protein that plays a crucial role in bacterial respiratory pathways. This enzyme catalyzes the conversion of heme B (protoheme IX) to heme O by substituting the vinyl group on carbon 2 of the heme B porphyrin ring with a hydroxyethyl farnesyl side group . This reaction represents a critical step in the biosynthesis of terminal oxidases required for bacterial respiration.

The protein is also known by alternative names including Heme B farnesyltransferase and Heme O synthase . It belongs to the enzyme classification EC 2.5.1.-, indicating its role as a transferase that forms carbon-carbon bonds .

Methodologically, researchers can assess ctaB activity through spectrophotometric assays that monitor the consumption of substrate (heme B) and formation of product (heme O), typically using HPLC separation followed by spectral analysis of the characteristic absorbance profiles of these heme derivatives.

What is known about the organism Opitutus terrae and how does this context inform ctaB research?

Opitutus terrae is a bacterium with the following characteristics:

  • Cells are cocci (spherical) and motile via flagellum

  • Lacks catalase and oxidase activities

  • Growth is supported by mono-, di-, and polysaccharides, but not by alcohols, amino acids, or organic acids

  • Major fermentation end-products include propionate and acetate

  • Can reduce nitrate to nitrite

  • Genomic DNA has a high G+C content of 74 mol%

The organism belongs to the phylum Verrucomicrobia and was initially isolated from rice paddy soil, representing a relatively under-studied bacterial group. Understanding the biochemical and physiological context of Opitutus terrae provides important insights for ctaB research, particularly regarding adaptations to anaerobic or microaerobic environments where heme-based respiratory systems may play specialized roles.

When designing experiments with recombinant Opitutus terrae ctaB, researchers should consider the native conditions of the source organism, including pH, temperature, and redox environment that may affect protein folding and activity.

What expression systems are most effective for producing recombinant Opitutus terrae ctaB?

Multiple expression systems have been successfully used to produce recombinant Opitutus terrae ctaB, each with distinct advantages for different research applications:

Expression SystemAdvantagesDisadvantagesRecommended Applications
E. coliHigh yield, rapid growth, economicalMay form inclusion bodies, potential improper foldingInitial characterization, antibody production
YeastPost-translational modifications, proper foldingSlower growth, lower yields than E. coliFunctional studies requiring properly folded protein
BaculovirusExcellent for membrane proteins, post-translational modificationsComplex methodology, higher costStructural studies, activity assays
Mammalian CellClosest to native eukaryotic modificationsMost expensive, lowest yieldInteraction studies with eukaryotic proteins

For recombinant ctaB production, researchers should consider using codon-optimized constructs, especially when expressing in heterologous systems, to improve translation efficiency . Expression typically employs vectors containing affinity tags (N-terminal or C-terminal) to facilitate purification, though tag selection should be carefully considered as it may affect protein activity or solubility .

What analytical approaches are recommended for characterizing ctaB enzymatic activity and substrate specificity?

Characterizing the enzymatic activity and substrate specificity of Protoheme IX farnesyltransferase requires specialized techniques due to the hydrophobic nature of both the enzyme and its substrates/products.

Recommended analytical approaches include:

  • In vitro enzyme assays: Using purified recombinant ctaB with heme B as substrate and detecting heme O formation. This typically requires:

    • Detergent solubilization of the enzyme (common detergents include DDM, LMNG, or digitonin)

    • Incorporation of a farnesyl diphosphate (FPP) donor

    • Anaerobic conditions to prevent heme oxidation

    • Monitoring by HPLC with UV-vis detection (characteristic absorption at 400-410 nm)

  • Substrate analog studies: Testing modified heme structures to determine specificity:

Substrate ModificationExpected EffectAnalytical Method
Vinyl group substitutionReduced or abolished activityLC-MS analysis of products
Porphyrin ring modificationsVariable effects depending on positionSpectrophotometric kinetic assays
Farnesyl donor variationsAltered kinetics or chain length of productHPLC-MS characterization
  • Kinetic analysis: Determining enzyme parameters (Km, Vmax, kcat) through initial velocity measurements under varying substrate concentrations, typically analyzed using Michaelis-Menten or Lineweaver-Burk plots.

  • Inhibitor studies: Using competitive and non-competitive inhibitors to characterize the enzyme active site and reaction mechanism.

For researchers new to this field, beginning with coupled enzyme assays that produce a more easily detectable signal (such as fluorescence or colorimetric change) may provide a more accessible entry point before transitioning to more complex direct assays.

How can researchers effectively study the impact of ctaB mutations on respiratory chain function?

Studying the impact of ctaB mutations on respiratory chain function requires a multi-faceted approach that combines genetic, biochemical, and physiological methods:

  • Site-directed mutagenesis strategy:

    • Target conserved residues identified through multiple sequence alignment

    • Focus on predicted active site residues and membrane-interfacing regions

    • Create a library of point mutations, especially targeting residues corresponding to those known to be functionally important in homologous proteins

  • Functional respiratory chain assessment:

    • Oxygen consumption measurements using Clark-type electrodes or optode systems

    • Membrane potential determination using fluorescent dyes (e.g., DiSC3(5) or JC-1)

    • Electron transfer activity measurement between respiratory complexes using artificial electron acceptors

  • Specific terminal oxidase activity assays:

    • Spectroscopic analysis of cytochrome c oxidation

    • NADH oxidation rates in membrane preparations

    • Specific inhibitor studies to distinguish between different terminal oxidases

  • In vivo phenotypic characterization:

    • Growth under varying oxygen tensions

    • Survival under oxidative stress conditions

    • Metabolic profiling under aerobic vs. anaerobic conditions

When designing mutation studies, researchers should incorporate the following table of commonly targeted mutation types and their potential impacts:

Mutation TypeResidue Selection CriteriaExpected Information Gained
ConservativePreserved across homologsEssential chemical properties
Non-conservativeActive site residuesSubstrate binding requirements
Deletion/truncationTerminal domainsDomain function in catalysis
Cysteine substitutionSurface-exposed residuesTopology mapping via accessibility
Alanine scanningThroughout proteinIdentify critical vs. dispensable regions

What are the methodological considerations for studying ctaB's role in bacterial persister cell formation?

The link between ctaB function and bacterial persister cell formation, particularly as observed in S. aureus , presents an intriguing area for research. Persister cells are phenotypic variants that exhibit tolerance to antibiotics without genetic resistance, and effective study of ctaB's role requires careful experimental design.

Key methodological considerations include:

  • Persister cell isolation and quantification:

    • Time-kill assays with suprainhibitory antibiotic concentrations

    • Biphasic killing curves analysis to distinguish persisters from resistant mutants

    • CFU counting on antibiotic-free media after antibiotic exposure

    • Single-cell microscopy with viability staining to directly observe persisters

  • Genetic approaches:

    • Construction of ctaB conditional expression strains (using inducible promoters)

    • Complementation with wild-type and mutant versions of ctaB

    • Transcriptional reporter fusions to monitor ctaB expression during persister formation

  • Metabolic analysis of persister state:

    • ATP measurements in persister-enriched populations

    • Membrane potential assessment in single cells

    • Respiration rate determination using oxygen-sensitive probes

    • Metabolomic profiling of persister vs. non-persister populations

  • Transcriptional regulation studies:

    • ChIP-seq to identify regulators binding to the ctaB promoter

    • RNA-seq comparing wild-type and ctaB mutant strains under persister-inducing conditions

    • qRT-PCR validation of key differentially expressed genes

When designing persister studies, researchers should be aware of the high variability inherent in persister assays and implement appropriate controls and statistical analyses. Using multiple antibiotics with different mechanisms of action can help distinguish general persister phenotypes from specific effects related to particular antibiotic classes.

How do structural and functional properties of ctaB compare across different bacterial species?

Comparative analysis of ctaB across bacterial species provides valuable insights into evolutionary conservation and functional adaptation. While the core catalytic function—converting heme B to heme O through farnesylation—is preserved, significant variations exist in structural features and regulatory contexts.

Based on available data, the following comparative analysis can be assembled:

Bacterial SpeciesProtein Size (aa)Key Structural FeaturesPhysiological ContextResearch Methods Used
Opitutus terrae295Multiple transmembrane domainsAnaerobic rice paddy soil bacteriumRecombinant expression studies
Staphylococcus aureus~370*Membrane-associatedKey role in virulence and persister formationGene deletion, RNA-seq, animal models
Escherichia coli (CtaB/CyoE)3119 transmembrane helicesWell-characterized respiratory chain componentCrystal structure, biochemical assays*
Bacillus subtilis~300*Similar to other Gram-positivesAerobic soil bacterium with complex developmentGenetic studies, enzyme assays*

*Note: Some values are approximate based on homologous proteins as exact data for all species was not available in the provided search results.

When studying ctaB across species, researchers should consider:

  • Sequence homology analysis:

    • Multiple sequence alignment to identify conserved motifs

    • Phylogenetic analysis to understand evolutionary relationships

    • Identification of species-specific insertions or deletions

  • Heterologous expression studies:

    • Cross-complementation experiments (e.g., expressing Opitutus terrae ctaB in S. aureus ctaB mutant)

    • Activity assays under standardized conditions to compare catalytic parameters

    • Structural studies to correlate sequence differences with functional variations

  • Ecological context consideration:

    • Analysis of ctaB adaptation to different environmental niches

    • Correlation of structural variations with oxygen availability in natural habitat

    • Examination of co-evolution with other respiratory chain components

This comparative approach not only enhances fundamental understanding of ctaB function but also provides insights into potential biotechnological applications and targeted inhibitor development.

What are the emerging research directions for ctaB studies?

Current evidence suggests several promising research directions for ctaB studies:

  • Antimicrobial development: The link between ctaB function and bacterial virulence suggests that inhibitors of this enzyme might represent a novel class of antivirulence compounds that could reduce pathogenicity without directly killing bacteria, potentially reducing selective pressure for resistance development.

  • Synthetic biology applications: Engineering ctaB variants with altered substrate specificity could enable production of novel heme derivatives with potential applications in biosensors or biocatalysis.

  • Systems biology integration: Positioning ctaB within global metabolic networks through multi-omics approaches could reveal unexpected connections between heme metabolism and other cellular processes.

  • Structural biology advancements: Application of emerging techniques like cryo-EM to membrane proteins may overcome historical challenges in obtaining high-resolution structures of ctaB and related enzymes.

  • Evolutionary analysis: Deeper investigation of ctaB distribution across bacterial phyla could provide insights into the evolution of respiratory chains and adaptation to varying oxygen environments.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.