Recombinant Opitutus terrae Ribonuclease Y (rny)

Shipped with Ice Packs
In Stock

Description

Research Context

While Opitutus terrae RNase Y is a novel recombinant product, its functional role is inferred from homology to Bacillus subtilis RNase Y, a well-studied endoribonuclease:

Role in RNA Degradation

RNase Y is a critical enzyme in initiating mRNA decay in Gram-positive bacteria. Key functions include:

  • Riboswitch turnover: Cleavage of SAM-dependent riboswitches upstream of aptamer domains .

  • Bulk mRNA stabilization: Depletion of RNase Y increases mRNA half-life by >2-fold in B. subtilis .

  • Autoregulation: RNase Y modulates its own mRNA stability via cleavage in the 5′ UTR .

Membrane Localization

RNase Y exhibits dynamic membrane localization, forming short-lived foci that interact with RNA substrates. Mutations in auxiliary proteins (e.g., Y-complex) increase focus density and size, suggesting a regulatory role in substrate specificity .

Applications

The recombinant Opitutus terrae RNase Y is tailored for:

  • RNA degradation studies: Investigating riboswitch turnover and mRNA decay mechanisms.

  • Structural biology: Crystallization or NMR studies to elucidate catalytic mechanisms.

  • Biotechnology: Potential use in RNA-based therapeutic development or synthetic biology.

Note: Functional data for Opitutus terrae RNase Y remain limited, as most studies focus on Bacillus subtilis orthologs .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
rny; Oter_0283; Ribonuclease Y; RNase Y
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-523
Protein Length
full length protein
Species
Opitutus terrae (strain DSM 11246 / JCM 15787 / PB90-1)
Target Names
rny
Target Protein Sequence
MSAADFAFLIAESDLFDWSLTVALVIGGALGFLVVWAFTRHTRRMAHEQAAELEEVARRE AAVAAEEIRQKAEAEIQEKRAELNRDFDRREIESEVRLREIRAHEESLALLDYQLEQRQE RLNRETAAMRQARDAIRALSKSVRQRLEGVSQMDAESIRQALREEVQLECQDELRALRRE IMEKSEQDLQTEGRRIMIAAMQRLASKPNNDLTSTIVSLPNEDMKGRIIGREGRNIKAFE AATGVTVLIDESPQTVLISSFDPIRREVARGALEALIKDGRIHPATIEEFVKRAHEEIEL SAMQAGEDAVTRLNINGLHPEIIKLLGKLKFRFSYNQNVLDHSVETASLASMIASEVGLD PNVAKRAGLLHDIGKAVNADYEGSHAHIGAEFIRRYGETPIVVNSVAAHHEEVKPETVYA GLVILADTISATRPGARAESMAGYIQRLGRLEKLAMAIDGVQQAFAIQAGREIRVVVSPQ TVTDDRAREIAKELRKRIEAELQYPSTIKITVIREQRFTETAT
Uniprot No.

Target Background

Function
Endoribonuclease initiating mRNA decay.
Database Links
Protein Families
RNase Y family
Subcellular Location
Cell membrane; Single-pass membrane protein.

Q&A

What is Opitutus terrae Ribonuclease Y (Rny) and what is its biological function?

Ribonuclease Y (Rny) from Opitutus terrae is an endoribonuclease involved in RNA processing and degradation. This enzyme belongs to a family of ribonucleases that initiate mRNA decay in bacteria. Based on studies of RNase Y in other bacterial species like Bacillus subtilis, these enzymes play crucial roles in controlling gene expression through selective RNA cleavage. RNase Y is particularly important in the turnover of riboswitches, which are regulatory RNA elements that modulate gene expression in response to metabolite binding .

The full-length protein consists of 523 amino acids and has a predicted molecular weight consistent with other bacterial ribonucleases. O. terrae itself is a gram-negative bacterium first isolated from soil samples, characterized by coccoid morphology and motility via flagella. This organism lacks catalase and oxidase activities but can utilize various carbohydrates for growth .

How is the structure of Ribonuclease Y conserved across bacterial species?

While the specific structural details of O. terrae Ribonuclease Y have not been fully characterized, research on homologous RNase Y proteins from other bacteria provides insight into likely structural features. RNase Y belongs to a family of endoribonucleases found in approximately 40% of sequenced bacterial species .

The amino acid sequence of O. terrae RNase Y (UniProt ID: B1ZQ93) suggests several conserved domains typical of this enzyme family. The full sequence (MSAADFAFLIAESDLFDWSLTVALVIGGALGFLVVWAFTRHTRRMAHEQAAELEEVARRE AAVAAEEIRQKAEAEIQEKRAELNRDFDRREIESEVRLREIRAHEESLALLDYQLEQRQE RLNRETAAMRQARDAIRALSKSVRQRLEGVSQMDAESIRQALREEVQLECQDELRALRRE IMEKSEQDLQTEGRRIMIAAMQRLASKPNNDLTSTIVSLPNEDMKGRIIGREGRNIKAFE AATGVTVLIDESPQTVLISSFDPIRREVARGALEALIKDGRIHPATIEEFVKRAHEEIEL SAMQAGEDAVTRLNINGLHPEIIKLLGKLKFRFSYNQNVLDHSVETASLASMIASEVGLD PNVAKRAGLLHDIGKAVNADYEGSHAHIGAEFIRRYGETPIVVNSVAAHHEEVKPETVYA GLVILADTISATRPGARAESMAGYIQRLGRLEKLAMAIDGVQQAFAIQAGREIRVVVSPQ TVTDDRAREIAKELRKRIEAELQYPSTIKITVIREQRFTETAT) contains regions likely involved in membrane association, RNA binding, and catalytic activity .

Based on studies of related RNase Y proteins, we can infer that the N-terminal region may contain a transmembrane domain, while the catalytic domain is likely located in the central portion of the protein.

What is the relationship between Opitutus terrae and its Ribonuclease Y in evolutionary context?

Opitutus terrae is a member of the Verrucomicrobia phylum, representing a distinct bacterial lineage. The organism was first characterized as a novel strain with unique phenotypic and phylogenetic properties . With a high G+C content of approximately 74 mol%, O. terrae's genome reflects its adaptation to specific ecological niches.

The presence of RNase Y in O. terrae is consistent with the observation that approximately 40% of sequenced bacterial species contain RNase Y orthologs . This suggests that RNase Y represents an ancient and important mechanism for RNA processing that has been conserved across diverse bacterial lineages, including those that diverged early in bacterial evolution.

Comparative genomic analyses would likely reveal both conserved and unique features of O. terrae RNase Y relative to homologs in other bacteria, potentially reflecting specific adaptations to the organism's ecological niche and metabolic requirements.

What are the key factors affecting catalytic activity of recombinant O. terrae RNase Y in experimental settings?

The catalytic activity of recombinant O. terrae RNase Y likely depends on several experimental factors that researchers should consider when designing experiments:

  • Protein conformation and integrity: As a full-length recombinant protein (523 amino acids) with an N-terminal His-tag, proper folding is essential for activity. The lyophilized form requires appropriate reconstitution in a compatible buffer system .

  • Buffer composition: Based on storage recommendations, Tris/PBS-based buffers at pH 8.0 appear compatible with the protein. Researchers should optimize buffer conditions including pH, ionic strength, and possible cofactors that might enhance enzymatic activity .

  • Substrate characteristics: Drawing from B. subtilis RNase Y studies, the phosphorylation state of the RNA substrate (particularly 5' monophosphorylation) may significantly influence activity. Additionally, RNA secondary structure likely plays a critical role in substrate recognition .

  • Presence of binding partners: In vivo, RNase Y may function within a larger degradosome complex. Research on B. subtilis suggests potential interactions with other RNA-processing enzymes that might modulate activity .

  • Experimental temperature and reaction time: Optimizing these parameters is essential, particularly given that O. terrae's natural environment may differ from standard laboratory conditions.

A systematic investigation of these factors would be necessary to establish optimal conditions for in vitro activity assays using the recombinant enzyme.

How might post-translational modifications affect the activity of native versus recombinant O. terrae RNase Y?

The recombinant O. terrae RNase Y protein is produced in E. coli expression systems, which may lead to differences in post-translational modifications compared to the native protein in O. terrae . These differences could potentially impact enzyme activity, localization, or stability.

Potential post-translational modifications that might occur in the native protein but be absent in the recombinant version include:

  • Phosphorylation: Regulatory phosphorylation sites might modulate RNase Y activity or interactions with other cellular components.

  • Membrane association: The presence of putative transmembrane domains in the N-terminal region suggests membrane localization in vivo, which might not be recapitulated in recombinant proteins expressed in E. coli.

  • Protein-protein interactions: In its native environment, RNase Y likely functions within a larger complex of RNA processing enzymes, potentially forming a "degradosome"-like structure similar to that observed in other bacteria.

Researchers investigating functional differences between native and recombinant RNase Y should consider complementary approaches, such as:

  • Expressing the protein in different host systems

  • Comparing the recombinant protein with native enzyme preparations

  • Investigating potential binding partners through pull-down assays or co-immunoprecipitation

  • Examining localization patterns in heterologous expression systems

These studies would provide insights into whether the recombinant protein accurately reflects the properties of the native enzyme in O. terrae.

What are the optimal conditions for reconstitution and storage of recombinant O. terrae RNase Y?

Based on the product information provided, the following reconstitution and storage protocols are recommended for maintaining optimal activity of recombinant O. terrae RNase Y:

Reconstitution Protocol:

  • Briefly centrifuge the vial containing lyophilized protein before opening to ensure all material is at the bottom.

  • Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.

  • Add glycerol to a final concentration of 5-50% (with 50% being the default recommendation) to enhance stability during storage.

  • Aliquot the reconstituted protein to minimize freeze-thaw cycles .

Storage Recommendations:

  • Store the lyophilized powder at -20°C/-80°C upon receipt.

  • Store reconstituted protein in working aliquots at 4°C for up to one week.

  • For long-term storage, keep aliquots at -20°C/-80°C.

  • Avoid repeated freeze-thaw cycles as these can significantly reduce enzyme activity .

Buffer Considerations:
The protein is provided in a Tris/PBS-based buffer containing 6% trehalose at pH 8.0. This buffer composition appears to maintain protein stability and can be considered as a starting point for experimental applications .

Researchers should validate enzyme activity after reconstitution using appropriate activity assays before proceeding with experimental applications.

What methods can be used to assess the enzymatic activity of recombinant O. terrae RNase Y?

Several complementary approaches can be employed to assess the enzymatic activity of recombinant O. terrae RNase Y:

In vitro RNA cleavage assays:

  • Defined RNA substrates: Based on studies of B. subtilis RNase Y, researchers can design RNA substrates with known secondary structures, particularly those mimicking riboswitch elements. Both 5' monophosphorylated and 5' triphosphorylated substrates should be tested to determine phosphorylation state preference .

  • Gel-based analysis of cleavage products: Denaturing polyacrylamide gel electrophoresis can be used to separate and visualize RNA fragments generated by RNase Y activity. Radioactive or fluorescent labeling of substrates enhances sensitivity.

Mapping cleavage sites:

  • Primer extension analysis: This technique can map the 5' ends of cleavage products with nucleotide resolution, as demonstrated for B. subtilis RNase Y .

  • 5'/3' RACE: This approach can identify both 5' and 3' ends of cleavage products and has been successfully applied to characterize RNase Y cleavage sites in vivo .

Kinetic measurements:

  • Real-time monitoring of substrate disappearance: Fluorescence-based assays using labeled substrates can provide quantitative data on cleavage rates.

  • Determination of enzymatic parameters: Systematic variation of substrate concentration allows calculation of Km and kcat values, enabling comparison with other ribonucleases.

Control experiments should include:

  • Heat-inactivated enzyme

  • Reactions with known ribonuclease inhibitors

  • Substrate variants lacking specific structural features

The combination of these approaches would provide comprehensive insights into the catalytic properties of O. terrae RNase Y.

How can researchers investigate the potential roles of O. terrae RNase Y in RNA metabolism pathways?

Investigating the roles of O. terrae RNase Y in RNA metabolism requires integrating multiple experimental approaches:

Genetic approaches:

  • Gene knockout or depletion: Construction of conditional mutants in O. terrae (or heterologous expression systems) could reveal the consequences of RNase Y deficiency on global RNA metabolism. Similar approaches in B. subtilis demonstrated that RNase Y depletion increased bulk mRNA half-life more than two-fold .

  • Complementation studies: Expressing O. terrae RNase Y in other bacterial species with RNase Y mutations could assess functional conservation.

Transcriptome analysis:

  • RNA-seq: Comparing transcriptome profiles between wild-type and RNase Y-depleted strains can identify RNAs whose abundance is affected by the enzyme.

  • TIER-seq (Transiently Inactivating an Endoribonuclease followed by RNA-seq): This approach can specifically identify direct targets of the ribonuclease.

Biochemical approaches:

  • RNA immunoprecipitation: Identifying RNAs that physically associate with RNase Y in vivo.

  • In vitro screening of potential substrates: Testing libraries of structured RNAs for susceptibility to cleavage.

Protein interaction studies:

  • Co-immunoprecipitation: Identifying proteins that associate with RNase Y, potentially forming a degradosome-like complex.

  • Bacterial two-hybrid assays: Mapping specific protein-protein interactions.

These approaches would provide a comprehensive understanding of O. terrae RNase Y's role in RNA metabolism, particularly in comparison to the well-studied B. subtilis enzyme.

How should researchers interpret differences in cleavage patterns between O. terrae RNase Y and homologs from other species?

When analyzing cleavage patterns of O. terrae RNase Y compared to homologs from other species (e.g., B. subtilis), researchers should consider several interpretative frameworks:

Structural determinants of specificity:

  • Differences in cleavage sites may reflect variations in the enzyme's catalytic domain structure or substrate-binding regions. Sequence alignment of RNase Y proteins across species can highlight conserved versus divergent regions that might explain altered specificity .

  • RNA structural features recognized by the enzyme might differ between species. For instance, B. subtilis RNase Y cleaves single-stranded regions near structured domains in riboswitches. O. terrae RNase Y might recognize similar or distinct structural motifs .

Evolutionary context:

  • Differences in specificity might reflect adaptation to the specific RNA targets present in each organism. Comparative genomic analysis of potential target RNAs across species could reveal co-evolution patterns.

  • The G+C content of O. terrae (74 mol%) differs significantly from B. subtilis, potentially resulting in different RNA structural tendencies that might influence enzyme specificity .

Methodological considerations:

  • Variations in experimental conditions (buffer composition, pH, temperature) might contribute to apparent differences in cleavage patterns.

  • The presence of the His-tag on recombinant O. terrae RNase Y might influence activity or specificity compared to the native enzyme .

A systematic comparison using identical RNA substrates under standardized conditions would provide the most reliable basis for interpreting species-specific differences in RNase Y function.

How can researchers integrate in vitro and in vivo data to develop comprehensive models of O. terrae RNase Y function?

Developing comprehensive models of O. terrae RNase Y function requires thoughtful integration of in vitro biochemical data with in vivo functional studies:

Data integration framework:

  • Establish correlations between in vitro and in vivo observations: For example, compare cleavage sites identified through in vitro assays with those detected in vivo through methods like 5' RACE or RNA-seq of RNase Y-depleted strains .

  • Identify context-dependent factors: In vivo, RNase Y activity might be modulated by cellular factors not present in purified in vitro systems. Systematic comparison can reveal these factors.

  • Develop kinetic models: Incorporate rate constants determined in vitro into mathematical models that account for in vivo conditions (substrate concentrations, competing reactions, etc.).

Computational approaches:

  • Network modeling: Position RNase Y within the broader RNA metabolism network, incorporating interactions with other ribonucleases and RNA-binding proteins.

  • Simulation of RNA decay pathways: Use stochastic or deterministic modeling approaches to simulate the impact of RNase Y on target RNA half-lives.

Experimental validation strategies:

  • Designer substrates: Create RNA substrates that test specific aspects of the model (e.g., structural requirements, sequence preferences) and validate both in vitro and in vivo.

  • Point mutations in RNase Y: Targeted mutations based on the model can test hypotheses about structure-function relationships.

A successful model should not only explain existing data but also make testable predictions about RNase Y function in novel contexts or with previously uncharacterized substrates.

What are the most promising applications of recombinant O. terrae RNase Y in RNA biology research?

Recombinant O. terrae RNase Y offers several promising applications for advancing RNA biology research:

Tool for RNA structure-function studies:

  • The apparent specificity of RNase Y for certain RNA structural contexts makes it a valuable probe for analyzing RNA folding and accessibility in complex RNAs.

  • Coupled with high-throughput sequencing, RNase Y could enable transcriptome-wide RNA structure mapping.

Model system for comparative ribonuclease studies:

  • As a member of an evolutionarily diverse bacterial phylum (Verrucomicrobia), O. terrae RNase Y provides an important comparative system for understanding ribonuclease evolution across bacterial lineages .

  • Comparing its properties with well-studied counterparts like B. subtilis RNase Y can reveal conserved principles of RNA processing .

Investigation of riboswitch mechanisms:

  • Given the importance of RNase Y in riboswitch turnover in B. subtilis, the O. terrae enzyme could be valuable for studying riboswitch dynamics and regulation .

  • The enzyme could help elucidate how RNA structural changes in response to metabolite binding influence susceptibility to ribonucleases.

Development of synthetic biology tools:

  • Engineered variants of RNase Y with altered specificity could be developed as tools for targeted RNA degradation in synthetic circuits.

  • Understanding RNase Y specificity could inform the design of RNA-based regulatory elements resistant to degradation.

These applications highlight the potential of O. terrae RNase Y to contribute significantly to both basic RNA biology research and biotechnological applications.

What unresolved questions about O. terrae RNase Y warrant further investigation?

Despite available information on recombinant O. terrae RNase Y, several important questions remain unresolved:

Structural biology questions:

  • What is the three-dimensional structure of O. terrae RNase Y, and how does it compare to homologs from other bacterial species?

  • How does the structure explain substrate recognition and catalytic mechanism?

  • What conformational changes occur upon substrate binding?

Functional questions:

  • What is the full range of RNA substrates targeted by O. terrae RNase Y in vivo?

  • Does O. terrae RNase Y participate in a degradosome-like complex similar to those described in other bacteria?

  • How is RNase Y activity regulated in response to changing cellular conditions?

Evolutionary questions:

  • What selective pressures have shaped the evolution of RNase Y in O. terrae compared to other bacterial lineages?

  • Are there functional adaptations specific to O. terrae's ecological niche?

  • How widespread is RNase Y among the Verrucomicrobia phylum?

Technical questions:

  • Can structure-guided protein engineering produce RNase Y variants with enhanced activity or altered specificity?

  • How can the recombinant enzyme be optimized for biotechnological applications?

Addressing these questions would significantly advance our understanding of RNA processing in O. terrae and contribute to broader knowledge of bacterial RNA metabolism.

How might comparative studies between O. terrae RNase Y and other bacterial endoribonucleases advance our understanding of RNA decay mechanisms?

Comparative studies between O. terrae RNase Y and other bacterial endoribonucleases hold significant potential for advancing our understanding of RNA decay mechanisms:

Evolutionary insights:

  • O. terrae represents a distinct bacterial lineage (Verrucomicrobia), providing an important evolutionary perspective compared to well-studied models like B. subtilis (Firmicutes) or E. coli (Proteobacteria) .

  • Comparing RNase Y across diverse bacterial phyla can reveal which features are ancestral versus derived, illuminating the evolutionary trajectory of RNA decay systems.

Functional diversity:

  • Distinct substrate preferences between RNase Y and other endoribonucleases (e.g., RNase E, RNase III) likely reflect different roles in RNA metabolism.

  • Systematic comparison of cleavage specificities could reveal how different enzymes cooperate to regulate the transcriptome.

Mechanistic understanding:

  • Structural comparisons between RNase Y and functionally similar enzymes (even those without sequence homology) might reveal convergent solutions to the challenge of specific RNA recognition and cleavage.

  • Understanding how different enzymes achieve similar functions can inform the design of synthetic ribonucleases.

Biotechnological applications:

  • Identifying unique properties of O. terrae RNase Y compared to other endoribonucleases could reveal specific advantages for biotechnological applications.

  • Combining features from different ribonucleases through protein engineering might produce enzymes with novel specificities.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.